254780281

254780281

cytochrome-c oxidase assembly factor protein

GeneID in NCBI database:8209263Locus tag:CLIBASIA_00830
Protein GI in NCBI database:254780281Protein Accession:YP_003064694.1
Gene range:-(168162, 168767)Protein Length:201aa
Gene description:cytochrome-c oxidase assembly factor protein
COG prediction:[R] Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems
KEGG prediction:cytochrome-c oxidase assembly factor protein; K07152
SEED prediction:Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Biogenesis of cytochrome c oxidases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
ccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccEEcHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHHHHHHHHHcccccEEEEccHHHHHHHHHHHccHHHHccccccccccccEEccccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccEEEEcccccEccHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHHcccccEcccccHHHHHHHHHHcEEEEEccccccccccccEEEccEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHccccc
MKALGIILGTILLAVLGSIAYVSfsskfvdgnrrfnsdvhlvaqdgtdfslsslyikpsivffgftncsavcpttLSRLDRLLkqvdptgtllNAYFitvdpkrdtpEVMKKFVQRFSDRiigisgdpiDVMRVAKNFRIYVNNVLaeksgveekyfVDHTTALLLFDtagsivgvipykddsdsAIEKINRLITYGNVVK
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYfitvdpkrdtpEVMKKFVQRFsdriigisgdpiDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIpykddsdsaiekinrlitygnvvk
MKAlgiilgtillavlgSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
MKALGIILGTILLAVLGSIAYVS************NSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL*****VEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG****
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target201 cytochrome-c oxidase assembly factor protein [Candidatu
315122841173 cytochrome-c oxidase assembly factor protein [Candidatu 1 3e-56
218682389200 electron transport protein SCO1/SenC [Rhizobium etli CI 1 4e-38
86358432199 cytochrome-c oxidase assembly factor protein [Rhizobium 1 6e-38
150397254199 electron transport protein SCO1/SenC [Sinorhizobium med 1 6e-38
327194604200 cytochrome c oxidase assembly factor protein [Rhizobium 1 3e-37
190892564200 cytochrome c oxidase assembly factor protein [Rhizobium 1 5e-37
222149110199 cytochrome c oxidase assembly factor transmembrane prot 1 6e-37
209550154200 electron transporter SCO1/SenC [Rhizobium leguminosarum 1 7e-37
116253029202 Sco copper chaperone family protein [Rhizobium legumino 1 9e-37
241205538200 electron transport protein SCO1/SenC [Rhizobium legumin 1 2e-36
>gi|315122841|ref|YP_004063330.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 173 Back     alignment and organism information
 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/154 (68%), Positives = 125/154 (81%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MKAL +ILGTIL AVLG +AY+ + SK    N++ +SDV LV Q+G + SLSSLY +PSI
Sbjct: 1   MKALAVILGTILFAVLGGVAYIVYDSKIEGTNQQLSSDVRLVTQEGVNISLSSLYTRPSI 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+CS VCPTTLS+LD  LK+VDPTG LLNAYFITVDPKRDTPE M KFV++FSDR
Sbjct: 61  VFFGFTHCSKVCPTTLSKLDGWLKKVDPTGKLLNAYFITVDPKRDTPEEMNKFVKKFSDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
           IIGISGDP  VM V K FR+YVNNVL ++S  E+
Sbjct: 121 IIGISGDPTSVMSVVKKFRVYVNNVLIDQSDPEK 154


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218682389|ref|ZP_03529990.1| electron transport protein SCO1/SenC [Rhizobium etli CIAT 894] Length = 200 Back     alignment and organism information
>gi|86358432|ref|YP_470324.1| cytochrome-c oxidase assembly factor protein [Rhizobium etli CFN 42] Length = 199 Back     alignment and organism information
>gi|150397254|ref|YP_001327721.1| electron transport protein SCO1/SenC [Sinorhizobium medicae WSM419] Length = 199 Back     alignment and organism information
>gi|327194604|gb|EGE61454.1| cytochrome c oxidase assembly factor protein [Rhizobium etli CNPAF512] Length = 200 Back     alignment and organism information
>gi|190892564|ref|YP_001979106.1| cytochrome c oxidase assembly factor protein [Rhizobium etli CIAT 652] Length = 200 Back     alignment and organism information
>gi|222149110|ref|YP_002550067.1| cytochrome c oxidase assembly factor transmembrane protein [Agrobacterium vitis S4] Length = 199 Back     alignment and organism information
>gi|209550154|ref|YP_002282071.1| electron transporter SCO1/SenC [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 200 Back     alignment and organism information
>gi|116253029|ref|YP_768867.1| Sco copper chaperone family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 202 Back     alignment and organism information
>gi|241205538|ref|YP_002976634.1| electron transport protein SCO1/SenC [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 200 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target201 cytochrome-c oxidase assembly factor protein [Candidatu
COG1999207 COG1999, COG1999, Uncharacterized protein SCO1/SenC/Prr 3e-30
KOG2792280 KOG2792, KOG2792, KOG2792, Putative cytochrome C oxidas 3e-24
pfam02630159 pfam02630, SCO1-SenC, SCO1/SenC 7e-24
cd02966116 cd02966, TlpA_like_family, TlpA-like family; composed o 7e-04
cd02968142 cd02968, SCO, SCO (an acronym for Synthesis of Cytochro 5e-32
>gnl|CDD|32182 COG1999, COG1999, Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>gnl|CDD|38003 KOG2792, KOG2792, KOG2792, Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|145666 pfam02630, SCO1-SenC, SCO1/SenC Back     alignment and domain information
>gnl|CDD|48515 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|48517 cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 201 cytochrome-c oxidase assembly factor protein [Candidatu
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved in bio 100.0
KOG2792280 consensus 100.0
pfam02630159 SCO1-SenC SCO1/SenC. This family is involved in biogene 100.0
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c Oxida 100.0
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin co 99.8
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, Try 99.78
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known as Cc 99.77
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetic 99.77
PRK09437156 bcp thioredoxin-dependent thiol peroxidase; Reviewed 99.77
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; compo 99.76
pfam00578124 AhpC-TSA AhpC/TSA family. This family contains proteins 99.76
cd02966116 TlpA_like_family TlpA-like family; composed of TlpA, Re 99.74
pfam08534142 Redoxin Redoxin. This family of redoxins includes perox 99.73
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for 99.73
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of the 99.73
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfami 99.72
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys P 99.71
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like sub 99.7
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, prot 99.69
cd02967114 mauD Methylamine utilization (mau) D family; mauD prote 99.67
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys 99.52
TIGR03137187 AhpC peroxiredoxin. This gene contains two invariant cy 99.47
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetic 99.46
PTZ00253199 tryparedoxin peroxidase; Provisional 99.45
PRK00522168 tpx thiol peroxidase; Provisional 99.45
PRK13599215 putative peroxiredoxin; Provisional 99.43
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamil 99.42
PRK13190202 putative peroxiredoxin; Provisional 99.41
PRK10382187 alkyl hydroperoxide reductase subunit C; Provisional 99.39
PRK13189215 peroxiredoxin; Provisional 99.38
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-de 99.37
PTZ00137194 2-Cys peroxiredoxin; Provisional 99.35
PTZ00056180 glutathione peroxidase; Provisional 99.33
PRK13191230 putative peroxiredoxin; Provisional 99.33
COG0450194 AhpC Peroxiredoxin [Posttranslational modification, pro 99.31
KOG2501157 consensus 99.23
PTZ00256183 glutathione peroxidase; Provisional 99.21
TIGR00385175 dsbE periplasmic protein thiol:disulfide oxidoreductase 99.07
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.0
COG0386162 BtuE Glutathione peroxidase [Posttranslational modifica 99.0
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was origina 98.97
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family; tet 98.94
KOG1651171 consensus 98.49
KOG0855211 consensus 98.39
TIGR02661189 MauD methylamine dehydrogenase accessory protein MauD; 98.38
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7; InterPro: IP 98.38
KOG0852196 consensus 98.34
TIGR01068101 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxi 98.25
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-termin 98.18
PRK09381109 trxA thioredoxin; Provisional 98.09
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reductase ( 98.04
PRK10996139 thioredoxin 2; Provisional 97.95
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfami 97.93
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, 97.91
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induced st 97.91
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion p 97.83
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protein fam 97.82
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical protei 97.81
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, prot 97.79
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin 97.77
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed of pro 97.62
KOG0910150 consensus 97.61
pfam00085104 Thioredoxin Thioredoxin. Thioredoxins are small enzymes 97.56
COG3118 304 Thioredoxin domain-containing protein [Posttranslationa 97.51
KOG0854224 consensus 97.48
PRK13703247 conjugal pilus assembly protein TraF; Provisional 97.48
PRK00293577 dipZ thiol:disulfide interchange protein precursor; Pro 97.44
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 97.3
TIGR02740306 TraF-like TraF-like protein; InterPro: IPR014111 This e 97.29
cd0294793 TRX_family TRX family; composed of two groups: Group I, 97.17
KOG0907106 consensus 97.1
pfam05176255 ATP-synt_10 ATP10 protein. ATP 10 is essential for the 97.09
PTZ0005198 thioredoxin; Provisional 97.02
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of euk 96.89
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of prote 96.86
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 96.79
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) family, 96.77
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryo 96.73
COG2143182 Thioredoxin-related protein [Posttranslational modifica 96.7
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; 96.65
PRK13728181 conjugal transfer protein TrbB; Provisional 96.62
TIGR02738176 TrbB type-F conjugative transfer system pilin assembly 96.57
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 96.54
cd02958114 UAS UAS family; UAS is a domain of unknown function. Mo 96.25
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; 96.21
pfam05988211 DUF899 Bacterial protein of unknown function (DUF899). 95.87
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulum pro 95.39
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monome 94.39
TIGR01130 522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 93.18
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; compos 91.91
TIGR01126107 pdi_dom protein disulfide-isomerase domain; InterPro: I 90.15
PRK03147176 thiol-disulfide oxidoreductase; Provisional 99.93
PRK10954207 periplasmic protein disulfide isomerase I; Provisional 96.84
KOG1731 606 consensus 90.87
pfam00255108 GSHPx Glutathione peroxidase. 97.41
PTZ00102 479 disulphide isomerase; Provisional 97.28
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; 97.11
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; compos 96.06
cd02962152 TMX2 TMX2 family; composed of proteins similar to human 95.88
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxi 95.73
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-like fa 95.23
cd02960130 AGR Anterior Gradient (AGR) family; members of this fam 94.52
pfam00837237 T4_deiodinase Iodothyronine deiodinase. Iodothyronine d 94.18
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (AP 94.05
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') 93.71
cd02957113 Phd_like Phosducin (Phd)-like family; composed of Phd a 93.43
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [Posttr 93.35
pfam06110119 DUF953 Eukaryotic protein of unknown function (DUF953). 93.17
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QS 92.17
KOG0190 493 consensus 91.41
KOG3425128 consensus 91.12
KOG0908 288 consensus 91.1
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 92.21
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>KOG2792 consensus Back     alignment and domain information
>pfam02630 SCO1-SenC SCO1/SenC Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>pfam00578 AhpC-TSA AhpC/TSA family Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>pfam08534 Redoxin Redoxin Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK00522 tpx thiol peroxidase; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2501 consensus Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>KOG1651 consensus Back     alignment and domain information
>KOG0855 consensus Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7; InterPro: IPR013376 This model represents one of several families of known and probable glutathione peroxidases Back     alignment and domain information
>KOG0852 consensus Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxins , , , are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>KOG0910 consensus Back     alignment and domain information
>pfam00085 Thioredoxin Thioredoxin Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0854 consensus Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein; InterPro: IPR014111 This entry contains TraF-like proteins that are related to the F-type conjugation system pilus assembly proteins TraF (IPR014110 from INTERPRO)and TrbB (IPR014109 from INTERPRO) both of which exhibit a thioredoxin fold Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>KOG0907 consensus Back     alignment and domain information
>pfam05176 ATP-synt_10 ATP10 protein Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>pfam05988 DUF899 Bacterial protein of unknown function (DUF899) Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>KOG1731 consensus Back     alignment and domain information
>pfam00255 GSHPx Glutathione peroxidase Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>pfam00837 T4_deiodinase Iodothyronine deiodinase Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>pfam06110 DUF953 Eukaryotic protein of unknown function (DUF953) Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>KOG0190 consensus Back     alignment and domain information
>KOG3425 consensus Back     alignment and domain information
>KOG0908 consensus Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target201 cytochrome-c oxidase assembly factor protein [Candidatu
2b7j_A200 Crystal Structure Of Yeast Sco1 With Copper Bound L 6e-24
2rli_A171 Solution Structure Of Cu(I) Human Sco2 Length = 171 1e-23
2gqk_A173 Solution Structure Of Human Ni(Ii)-Sco1 Length = 17 3e-23
2hrf_A173 Solution Structure Of Cu(I) P174l Hsco1 Length = 17 4e-23
2ggt_A164 Crystal Structure Of Human Sco1 Complexed With Nick 3e-22
1wp0_A165 Human Sco1 Length = 165 3e-21
2k6v_A172 Solution Structures Of Apo Sco1 Protein From Thermu 2e-18
1xzo_A174 Identification Of A Disulfide Switch In Bssco, A Me 2e-16
1on4_A174 Solution Structure Of Soluble Domain Of Sco1 From B 5e-16
1st9_A143 Crystal Structure Of A Soluble Domain Of Resa In Th 1e-10
2h1b_A143 Resa E80q Length = 143 2e-10
3c71_A143 Struture Of A Resa Variant With A Dsba-Like Active 2e-10
3c73_A140 Structure Of Cehc Variant Resa Length = 140 3e-10
2h1a_A143 Resa C74a Variant Length = 143 4e-10
2h19_A143 Crystal Structure Of Resa Cys77ala Variant Length = 8e-10
2h1g_A143 Resa C74aC77A Length = 143 6e-09
2l5o_A153 Solution Structure Of A Putative Thioredoxin From N 6e-07
2f9s_A151 2nd Crystal Structure Of A Soluble Domain Of Resa I 1e-06
2ywn_A157 Crystal Structure Of Peroxiredoxin-Like Protein Fro 4e-05
3cyn_A189 The Structure Of Human Gpx8 Length = 189 5e-05
3kij_A180 Crystal Structure Of The Human Pdi-Peroxidase Lengt 8e-05
1e2y_A188 Tryparedoxin Peroxidase From Crithidia Fasciculata 1e-04
3me7_A170 Crystal Structure Of Putative Electron Transport Pr 3e-04
2p5q_A170 Crystal Structure Of The Poplar Glutathione Peroxid 0.001
3kcm_A154 The Crystal Structure Of Thioredoxin Protein From G 0.003
1xxu_A153 Crystal Structure Of Ahpe From Mycrobacterium Tuber 0.004
>gi|99031874|pdb|2B7J|A Chain A, Crystal Structure Of Yeast Sco1 With Copper Bound Length = 200 Back     alignment and structure
 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 3/167 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDP 88
            G        HL    G +F+  +L  K SI++FGF+NC  +CP  L +L   L      
Sbjct: 15  YGKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSK 74

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
            G  L   FIT DP RD+P V+K+++  F   I+G++G   +V    K +R+Y +     
Sbjct: 75  YGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPP-- 132

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                + Y VDH+    L D  G  V  +    D  + ++KI   + 
Sbjct: 133 NVKPGQDYLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVK 179


>gi|158430849|pdb|2RLI|A Chain A, Solution Structure Of Cu(I) Human Sco2 Length = 171 Back     alignment and structure
>gi|109157954|pdb|2GQK|A Chain A, Solution Structure Of Human Ni(Ii)-Sco1 Length = 173 Back     alignment and structure
>gi|126030639|pdb|2HRF|A Chain A, Solution Structure Of Cu(I) P174l Hsco1 Length = 173 Back     alignment and structure
>gi|109157847|pdb|2GGT|A Chain A, Crystal Structure Of Human Sco1 Complexed With Nickel. Length = 164 Back     alignment and structure
>gi|60593905|pdb|1WP0|A Chain A, Human Sco1 Length = 165 Back     alignment and structure
>gi|198443051|pdb|2K6V|A Chain A, Solution Structures Of Apo Sco1 Protein From Thermus Thermophilus Length = 172 Back     alignment and structure
>gi|61680480|pdb|1XZO|A Chain A, Identification Of A Disulfide Switch In Bssco, A Member Of The Sco Family Of Cytochrome C Oxidase Assembly Proteins Length = 174 Back     alignment and structure
>gi|39654376|pdb|1ON4|A Chain A, Solution Structure Of Soluble Domain Of Sco1 From Bacillus Subtilis Length = 174 Back     alignment and structure
>gi|49259146|pdb|1ST9|A Chain A, Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 143 Back     alignment and structure
>gi|116667529|pdb|2H1B|A Chain A, Resa E80q Length = 143 Back     alignment and structure
>gi|196049759|pdb|3C71|A Chain A, Struture Of A Resa Variant With A Dsba-Like Active Site Motif (Cphc) Length = 143 Back     alignment and structure
>gi|196049760|pdb|3C73|A Chain A, Structure Of Cehc Variant Resa Length = 140 Back     alignment and structure
>gi|116667527|pdb|2H1A|A Chain A, Resa C74a Variant Length = 143 Back     alignment and structure
>gi|116667525|pdb|2H19|A Chain A, Crystal Structure Of Resa Cys77ala Variant Length = 143 Back     alignment and structure
>gi|116667537|pdb|2H1G|A Chain A, Resa C74aC77A Length = 143 Back     alignment and structure
>gi|315113185|pdb|2L5O|A Chain A, Solution Structure Of A Putative Thioredoxin From Neisseria Meningitidis Length = 153 Back     alignment and structure
>gi|99032200|pdb|2F9S|A Chain A, 2nd Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 151 Back     alignment and structure
>gi|159795627|pdb|2YWN|A Chain A, Crystal Structure Of Peroxiredoxin-Like Protein From Sulfolobus Tokodaii Length = 157 Back     alignment and structure
>gi|196049795|pdb|3CYN|A Chain A, The Structure Of Human Gpx8 Length = 189 Back     alignment and structure
>gi|317455150|pdb|3KIJ|A Chain A, Crystal Structure Of The Human Pdi-Peroxidase Length = 180 Back     alignment and structure
>gi|13786919|pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 Back     alignment and structure
>gi|294662596|pdb|3ME7|A Chain A, Crystal Structure Of Putative Electron Transport Protein Aq_2194 From Aquifex Aeolicus Vf5 Length = 170 Back     alignment and structure
>gi|157835621|pdb|2P5Q|A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form Length = 170 Back     alignment and structure
>gi|266618826|pdb|3KCM|A Chain A, The Crystal Structure Of Thioredoxin Protein From Geobacter Metallireducens Length = 154 Back     alignment and structure
gi|61680459|pdb|1XXU|A Chain A, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 153 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target201 cytochrome-c oxidase assembly factor protein [Candidatu
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxidase, m 4e-21
2k6v_A172 Putative cytochrome C oxidase assembly protein; thiored 2e-16
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaperone, 7e-16
3me7_A170 Putative uncharacterized protein; electron transfer pro 7e-15
2rli_A171 SCO2 protein homolog, mitochondrial; copper protein, th 5e-13
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like fold 4e-10
3or5_A165 Thiol:disulfide interchange protein, thioredoxin protei 1e-05
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, oxido 3e-05
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidoreduct 3e-05
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomics, AP 9e-05
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxi 1e-04
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, cytoplasm, o 1e-04
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredoxin-l 4e-04
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, structural 6e-04
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, 6e-04
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreductase, P 0.001
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved protein, 0.002
2vup_A190 Glutathione peroxidase-like protein; oxidoreductase, tr 0.002
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, PSI, M 0.002
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Length = 200 Back     alignment and structure
 Score = 96.5 bits (239), Expect = 4e-21
 Identities = 50/165 (30%), Positives = 79/165 (47%), Gaps = 3/165 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G        HL    G +F+  +L  K SI++FGF+NC  +CP  L +L   L  +    
Sbjct: 16  GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKY 75

Query: 91  TLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
            +     FIT DP RD+P V+K+++  F   I+G++G   +V    K +R+Y +     K
Sbjct: 76  GITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVK 135

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            G  + Y VDH+    L D  G  V  +    D  + ++KI   +
Sbjct: 136 PG--QDYLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHV 178


>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Length = 172 Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Length = 164 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Length = 170 Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Length = 171 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal- kingston bacterial structural genomics initiative; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Length = 174 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Length = 169 Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Length = 170 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, TLPA-like family, PSI-2, protein structure initiative; 1.74A {Bacteroides thetaiotaomicron} Length = 150 Back     alignment and structure
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, cytoplasm, oxidoreductase, peroxidase, redox-active center; 2.02A {Saccharomyces cerevisiae} Length = 171 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB structural genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis H37RV} Length = 352 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.76A {Thermus thermophilus HB27} Length = 154 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein structure initiative; HET: MSE; 1.30A {Bacteroides fragilis nctc 9343} Length = 142 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, oxidoreductase, dithiol-dependant peroxidase; 2.1A {Trypanosoma brucei} Length = 190 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Length = 183 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target201 cytochrome-c oxidase assembly factor protein [Candidatu
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxidase, m 100.0
2k6v_A172 Putative cytochrome C oxidase assembly protein; thiored 100.0
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like fold 100.0
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaperone, 100.0
2rli_A171 SCO2 protein homolog, mitochondrial; copper protein, th 99.98
3me7_A170 Putative uncharacterized protein; electron transfer pro 99.97
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathione pe 99.9
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3-laye 99.89
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathione pe 99.89
2vup_A190 Glutathione peroxidase-like protein; oxidoreductase, tr 99.87
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, oxido 99.87
3or5_A165 Thiol:disulfide interchange protein, thioredoxin protei 99.87
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, structural 99.86
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, cytoplasm, o 99.86
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, PSI, M 99.85
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredoxin-l 99.84
3cyn_A189 Probable glutathione peroxidase 8; thioredoxin fold, me 99.84
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidoreduct 99.84
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomics, AP 99.83
3ixr_A179 Bacterioferritin comigratory protein; alpha beta protei 99.83
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, NPGP 99.82
2ywn_A157 Peroxiredoxin-like protein; redox protein, structural g 99.82
2cx4_A164 Bacterioferritin comigratory protein; oxidoreductase, a 99.81
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreductase, P 99.81
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-like p 99.81
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, atypica 99.81
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin protein, P 99.79
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, 99.79
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thioredox 99.79
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like supe 99.78
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-beta fo 99.78
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like fold, 99.78
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; redox p 99.78
2ywi_A196 Hypothetical conserved protein; uncharacterized conserv 99.77
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomics, PS 99.77
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; oxid 99.76
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, structu 99.76
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved protein, 99.76
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreductase; N 99.75
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin fold, 99.74
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , stru 99.74
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCSG, st 99.74
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI, pro 99.72
3drn_A161 Peroxiredoxin, bacterioferritin comigratory protein hom 99.71
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thiored 99.71
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, structura 99.71
2yzh_A171 Probable thiol peroxidase; redox protein, antioxidant, 99.7
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like, thi 99.7
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron r 99.69
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane, dod 99.69
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, o 99.68
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxi 99.68
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductase MSR 99.68
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, oxido 99.68
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidant def 99.68
3keb_A224 Probable thiol peroxidase; structural genomics, APC4067 99.67
2jsy_A167 Probable thiol peroxidase; solution structure, antioxid 99.67
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; peroxi 99.67
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-terminal th 99.66
3hvv_A167 Thiol peroxidase, scavengase P20; oxidoreductase, TPX, 99.64
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sulphini 99.64
1psq_A163 Probable thiol peroxidase; structural genomics, NYSGXRC 99.64
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, structural 99.64
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, thior 99.64
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural genomics 99.64
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, structural 99.64
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.40A {C 99.63
2i81_A213 2-Cys peroxiredoxin; structural genomics consortium, SG 99.62
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXRC, PS 99.62
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredoxin f 99.62
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hydroge 99.59
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1 99.58
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-shaped 99.57
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural genom 99.55
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, aty 99.53
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox regulati 99.49
2i3y_A215 Epididymal secretory glutathione peroxidase; thioredoxi 99.33
2r37_A207 Glutathione peroxidase 3; plasma, structural genomics c 99.32
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enz 99.03
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, subst 99.02
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredoxin f 98.84
3f9u_A172 Putative exported cytochrome C biogenesis- related prot 98.79
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidoreductas 98.79
2l57_A126 Uncharacterized protein; structural genomics, unknown f 98.77
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sandwich, 98.73
2kuc_A130 Putative disulphide-isomerase; structural genomics, thi 98.6
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, riken 98.54
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protein, ox 98.5
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bacteroid 98.48
3fk8_A133 Disulphide isomerase; APC61824.1, structural genomics, 98.36
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, el 98.36
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protein str 98.35
3gnj_A111 Thioredoxin domain protein; APC92103, structural genomi 98.33
1t00_A112 Thioredoxin, TRX; structure, redox regulation, multifun 98.29
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredoxin-l 98.29
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electron tr 98.25
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cytoplas 98.22
2voc_A112 Thioredoxin; electron transport, homodimer, disulfide, 98.2
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, chlorop 98.18
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus toko 98.18
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 98.15
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichia col 98.13
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; struc 98.12
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, 98.12
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mitocho 98.04
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, electron t 98.04
1r26_A125 Thioredoxin; redox-active disulfide, electron transport 98.03
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, th 98.03
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 98.0
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxidoredu 97.98
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} P 97.98
1gh2_A107 Thioredoxin-like protein; redox-active center, electron 97.97
1xwb_A106 Thioredoxin; dimerization, redox regulation, X-RAY elec 97.96
1zma_A118 Bacterocin transport accessory protein; alpha-beta-alph 97.95
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, 97.95
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta protein, 97.95
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, redo 97.95
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, protein 97.94
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.3 97.91
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron transp 97.91
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia oler 97.89
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain-cont 97.88
1nsw_A105 Thioredoxin, TRX; thermostability, electron transport; 97.88
2yzu_A109 Thioredoxin; redox protein, electron transport, structu 97.84
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A {Chl 97.83
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, PSI-2 97.82
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, antibod 97.81
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ERP72, 97.81
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulum, RP 97.79
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-protein 97.75
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross-reac 97.71
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxidoreduc 97.69
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide reducta 97.68
2diz_A117 Thioredoxin domain-containing protein 5; thioredoxin-li 97.67
2dlx_A153 UBX domain-containing protein 7; UAS domain, protein KI 97.66
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, 97.66
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomonas vag 97.63
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tr 97.63
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytoplasm, 97.56
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase and th 97.55
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sandwich, 97.43
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXNDC1, s 97.42
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, protein st 97.4
3dml_A116 Putative uncharacterized protein; thioredoxin, oxidored 97.39
2qsi_A137 Putative hydrogenase expression/formation protein HUPG; 97.35
1mek_A120 Protein disulfide isomerase; electron transport, redox- 97.34
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin fold 97.15
1x5c_A121 Protein disulfide-isomerase; DSI, ERBA2L, GIT, PDI, PDI 97.11
1wmj_A130 Thioredoxin H-type; structural genomics, program for RI 96.86
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) sand 96.82
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ERP72, 96.81
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, HFAF 96.2
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold; 1.9 96.14
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase, DSB 95.99
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like fold, 95.88