254780282

254780282

putative transcription regulator protein

GeneID in NCBI database:8209264Locus tag:CLIBASIA_00835
Protein GI in NCBI database:254780282Protein Accession:YP_003064695.1
Gene range:-(169094, 169993)Protein Length:299aa
Gene description:putative transcription regulator protein
COG prediction:[K] Transcriptional regulator
KEGG prediction:putative transcription regulator protein
SEED prediction:Transcriptional regulator, LysR family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
ccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcHHHHHccHHHHHHHHHHccccEEEEEEccHHHHHHcccccEEEEEcccccccccEEEEEccccEEEEccccHHHHccccccHHHHccccEEEEcccccccHHHHHHHHHcccccccccEEEEEEcHHHHHHHHHHccccEEEccHHHHcccccEEEEcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHccc
ccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccEEccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEHHHcccEEEEEEccccccccHEEEEcccccEEEEEcHHHHHHccccccHHHHHcccEEEEcccccccccccHHEccccccEEEccccEEEEccHHHHHHHHHcccccEccccHEEcccccEEEcccccccccccEEEEccccccccHHHHHHHHHHHHHHHHccc
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHargltlteqgsklhrVTSEVYHKLETTQIElqessvkpsgklrIATTIDLGQNLLQGNLKEFLLLYPDIQIQlildnkdidismDYADCAIrlrkpiqsssLIQRKLVTIHMHAyaaphylkncreplsiqeldkhnlitfgdlipKCMEDfnwlatvdrpigeprisclqvNSYLSIMQYCVLGsgiallpdyivkdnpnlVRIMedvitpsftvyfcypealkntgkLKAFRNFIFLKARDWKF
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGltlteqgsklhrVTSEVYHKLettqielqessvkpsgkLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRlrkpiqssslIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFlkardwkf
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
*SFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLET***************LRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFN***********PRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDW**
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
*SFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF
MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target299 putative transcription regulator protein [Candidatus Li
254780399 594 DNA mismatch repair protein [Candidatus Liberibact 0.023
>gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 594 Back     alignment
 Score = 31.2 bits (69), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 34/109 (31%)

Query: 119 YPDIQIQLILDNKDIDISMDYADCAIRLRKP-------------------IQSSSLIQRK 159
           YP + + L +D + +D+++  A   IR R P                   I +SS++ +K
Sbjct: 281 YPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK 340

Query: 160 LVT---------IHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIP 199
           +++          H+  YA    L N +E L +QE    N ++  DL+P
Sbjct: 341 MISSFHQDNAPKTHLPKYAT--SLTNTQEKLFLQE----NRLSTNDLLP 383

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target299 putative transcription regulator protein [Candidatus Li
315122842298 putative transcription regulator protein [Candidatus Li 1 1e-142
227822113298 transcriptional regulator, LysR family [Sinorhizobium f 1 1e-101
15965319302 putative transcription regulator protein [Sinorhizobium 1 2e-99
150396465298 LysR family transcriptional regulator [Sinorhizobium me 1 3e-99
222086562303 transcriptional regulator protein [Agrobacterium radiob 1 1e-97
86358578298 LysR family transcriptional regulator [Rhizobium etli C 1 1e-97
116253171303 LysR family transcriptional regulator [Rhizobium legumi 1 2e-97
325293546300 transcriptional regulator, LysR family [Agrobacterium s 1 4e-97
15889466300 LysR family transcriptional regulator [Agrobacterium tu 1 4e-97
209550302303 LysR family transcriptional regulator [Rhizobium legumi 1 1e-96
>gi|315122842|ref|YP_004063331.1| putative transcription regulator protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Back     alignment and organism information
 Score =  507 bits (1306), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/299 (82%), Positives = 267/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLT 60
           MSFDWDKLRVFYVVA+ GSFT AAEQL+LSQS+ISRQISGLE E+G KLFYRHARGL LT
Sbjct: 1   MSFDWDKLRVFYVVAKFGSFTSAAEQLNLSQSAISRQISGLEAEIGSKLFYRHARGLILT 60

Query: 61  EQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYP 120
           EQGSKLH V S+V  KLE+ QIELQESS KPSGKLRIATTIDLGQNLLQ + KEFLLLYP
Sbjct: 61  EQGSKLHNVASDVCQKLESIQIELQESSEKPSGKLRIATTIDLGQNLLQDSFKEFLLLYP 120

Query: 121 DIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREP 180
           DI+IQ ILDNKDIDISM YADCAIRLRKP QSS LIQRKLVTI+MH YAAPHYLK   EP
Sbjct: 121 DIKIQFILDNKDIDISMCYADCAIRLRKPSQSS-LIQRKLVTINMHVYAAPHYLKRRGEP 179

Query: 181 LSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSG 240
           LSIQ+LD H+L+TFGDLIPKCMEDFNWLATV R   EPRIS LQ+NSYLSIMQYC+LGSG
Sbjct: 180 LSIQDLDNHDLLTFGDLIPKCMEDFNWLATVGRAPHEPRISSLQINSYLSIMQYCILGSG 239

Query: 241 IALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARDWKF 299
           IALLPDYIVKDN N+VR+MEDV  PSF VYFCYPEALKNTGKLKAFR+FI LKA++WKF
Sbjct: 240 IALLPDYIVKDNSNIVRVMEDVSMPSFEVYFCYPEALKNTGKLKAFRDFIVLKAQNWKF 298


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822113|ref|YP_002826084.1| transcriptional regulator, LysR family [Sinorhizobium fredii NGR234] Length = 298 Back     alignment and organism information
>gi|15965319|ref|NP_385672.1| putative transcription regulator protein [Sinorhizobium meliloti 1021] Length = 302 Back     alignment and organism information
>gi|150396465|ref|YP_001326932.1| LysR family transcriptional regulator [Sinorhizobium medicae WSM419] Length = 298 Back     alignment and organism information
>gi|222086562|ref|YP_002545096.1| transcriptional regulator protein [Agrobacterium radiobacter K84] Length = 303 Back     alignment and organism information
>gi|86358578|ref|YP_470470.1| LysR family transcriptional regulator [Rhizobium etli CFN 42] Length = 298 Back     alignment and organism information
>gi|116253171|ref|YP_769009.1| LysR family transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 303 Back     alignment and organism information
>gi|325293546|ref|YP_004279410.1| transcriptional regulator, LysR family [Agrobacterium sp. H13-3] Length = 300 Back     alignment and organism information
>gi|15889466|ref|NP_355147.1| LysR family transcriptional regulator [Agrobacterium tumefaciens str. C58] Length = 300 Back     alignment and organism information
>gi|209550302|ref|YP_002282219.1| LysR family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 303 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target299 putative transcription regulator protein [Candidatus Li
cd08422197 cd08422, PBP2_CrgA_like, The C-terminal substrate bindi 9e-36
pfam03466209 pfam03466, LysR_substrate, LysR substrate binding domai 4e-22
cd08480198 cd08480, PBP2_CrgA_like_10, The C-terminal substrate bi 2e-18
cd08473202 cd08473, PBP2_CrgA_like_4, The C-terminal substrate bin 2e-16
cd08472202 cd08472, PBP2_CrgA_like_3, The C-terminal substrate bin 3e-16
cd08477197 cd08477, PBP2_CrgA_like_8, The C-terminal substrate bin 6e-16
cd08470197 cd08470, PBP2_CrgA_like_1, The C-terminal substrate bin 3e-15
cd08474202 cd08474, PBP2_CrgA_like_5, The C-terminal substrate bin 8e-15
cd08479198 cd08479, PBP2_CrgA_like_9, The C-terminal substrate bin 3e-14
cd05466197 cd05466, PBP2_LTTR_substrate, The substrate binding dom 8e-14
cd08475199 cd08475, PBP2_CrgA_like_6, The C-terminal substrate bin 1e-12
cd08471201 cd08471, PBP2_CrgA_like_2, The C-terminal substrate bin 2e-11
cd08432194 cd08432, PBP2_GcdR_TrpI_HvrB_AmpR_like, The C-terminal 1e-10
cd08478199 cd08478, PBP2_CrgA, The C-terminal substrate binding do 2e-10
cd08476197 cd08476, PBP2_CrgA_like_7, The C-terminal substrate bin 2e-10
cd08481194 cd08481, PBP2_GcdR_like, The C-terminal substrate bindi 5e-05
PRK11139297 PRK11139, PRK11139, DNA-binding transcriptional activat 2e-24
TIGR03418291 TIGR03418, chol_sulf_TF, putative choline sulfate-utili 2e-20
PRK09801310 PRK09801, PRK09801, transcriptional activator TtdR; Pro 3e-20
PRK12682309 PRK12682, PRK12682, transcriptional regulator CysB-like 1e-14
PRK09906296 PRK09906, PRK09906, DNA-binding transcriptional regulat 4e-12
PRK12679316 PRK12679, cbl, transcriptional regulator Cbl; Reviewed 1e-10
COG0583297 COG0583, LysR, Transcriptional regulator [Transcription 3e-37
TIGR03339279 TIGR03339, phn_lysR, aminoethylphosphonate catabolism a 9e-22
PRK10632309 PRK10632, PRK10632, transcriptional regulator; Provisio 4e-20
PRK11242296 PRK11242, PRK11242, DNA-binding transcriptional regulat 2e-15
PRK15092310 PRK15092, PRK15092, DNA-binding transcriptional repress 3e-12
PRK09986294 PRK09986, PRK09986, DNA-binding transcriptional activat 6e-10
pfam0012660 pfam00126, HTH_1, Bacterial regulatory helix-turn-helix 2e-20
PRK10094308 PRK10094, PRK10094, DNA-binding transcriptional activat 5e-12
TIGR02424300 TIGR02424, TF_pcaQ, pca operon transcription factor Pca 5e-10
PRK11074300 PRK11074, PRK11074, putative DNA-binding transcriptiona 4e-09
TIGR03298292 TIGR03298, argP, transcriptional regulator, ArgP family 2e-08
PRK13348294 PRK13348, PRK13348, chromosome replication initiation i 5e-08
PRK03601275 PRK03601, PRK03601, transcriptional regulator HdfR; Pro 6e-08
PRK11233305 PRK11233, PRK11233, nitrogen assimilation transcription 1e-07
PRK11062296 PRK11062, nhaR, transcriptional activator NhaR; Provisi 4e-06
PRK11151305 PRK11151, PRK11151, DNA-binding transcriptional regulat 4e-05
PRK10086311 PRK10086, PRK10086, DNA-binding transcriptional regulat 3e-20
PRK14997301 PRK14997, PRK14997, LysR family transcriptional regulat 4e-16
PRK12684313 PRK12684, PRK12684, transcriptional regulator CysB-like 2e-11
PRK10837290 PRK10837, PRK10837, putative DNA-binding transcriptiona 9e-11
PRK12683309 PRK12683, PRK12683, transcriptional regulator CysB-like 1e-10
TIGR02036302 TIGR02036, dsdC, D-serine deaminase transcriptional act 3e-16
CHL00180305 CHL00180, rbcR, LysR transcriptional regulator; Provisi 3e-13
PRK09791302 PRK09791, PRK09791, putative DNA-binding transcriptiona 2e-11
PRK11716269 PRK11716, PRK11716, DNA-binding transcriptional regulat 8e-11
PRK10341312 PRK10341, PRK10341, DNA-binding transcriptional activat 1e-10
PRK12681324 PRK12681, cysB, transcriptional regulator CysB; Reviewe 3e-09
PRK11013309 PRK11013, PRK11013, DNA-binding transcriptional regulat 4e-08
PRK15421317 PRK15421, PRK15421, DNA-binding transcriptional regulat 6e-08
PRK12680327 PRK12680, PRK12680, transcriptional regulator CysB-like 0.004
PRK10082303 PRK10082, PRK10082, cell density-dependent motility rep 2e-08
PRK03635294 PRK03635, PRK03635, chromosome replication initiation i 2e-07
PRK15243297 PRK15243, PRK15243, transcriptional regulator SpvR; Pro 2e-05
cd08415196 cd08415, PBP2_LysR_opines_like, The C-terminal substrat 0.003
>gnl|CDD|176114 cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain Back     alignment and domain information
>gnl|CDD|146222 pfam03466, LysR_substrate, LysR substrate binding domain Back     alignment and domain information
>gnl|CDD|176169 cd08480, PBP2_CrgA_like_10, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176162 cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176161 cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176166 cd08477, PBP2_CrgA_like_8, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176159 cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain Back     alignment and domain information
>gnl|CDD|176163 cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176168 cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176102 cd05466, PBP2_LTTR_substrate, The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|176164 cd08475, PBP2_CrgA_like_6, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176160 cd08471, PBP2_CrgA_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176123 cd08432, PBP2_GcdR_TrpI_HvrB_AmpR_like, The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176167 cd08478, PBP2_CrgA, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain Back     alignment and domain information
>gnl|CDD|176165 cd08476, PBP2_CrgA_like_7, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176170 cd08481, PBP2_GcdR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|182990 PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>gnl|CDD|132459 TIGR03418, chol_sulf_TF, putative choline sulfate-utilization transcription factor Back     alignment and domain information
>gnl|CDD|182085 PRK09801, PRK09801, transcriptional activator TtdR; Provisional Back     alignment and domain information
>gnl|CDD|183679 PRK12682, PRK12682, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|182137 PRK09906, PRK09906, DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>gnl|CDD|183676 PRK12679, cbl, transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>gnl|CDD|30928 COG0583, LysR, Transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|132382 TIGR03339, phn_lysR, aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>gnl|CDD|182601 PRK10632, PRK10632, transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|183051 PRK11242, PRK11242, DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>gnl|CDD|185048 PRK15092, PRK15092, DNA-binding transcriptional repressor LrhA; Provisional Back     alignment and domain information
>gnl|CDD|182183 PRK09986, PRK09986, DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>gnl|CDD|143900 pfam00126, HTH_1, Bacterial regulatory helix-turn-helix protein, lysR family Back     alignment and domain information
>gnl|CDD|182237 PRK10094, PRK10094, DNA-binding transcriptional activator AllS; Provisional Back     alignment and domain information
>gnl|CDD|162852 TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ Back     alignment and domain information
>gnl|CDD|182948 PRK11074, PRK11074, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|163206 TIGR03298, argP, transcriptional regulator, ArgP family Back     alignment and domain information
>gnl|CDD|183989 PRK13348, PRK13348, chromosome replication initiation inhibitor protein; Provisional Back     alignment and domain information
>gnl|CDD|179604 PRK03601, PRK03601, transcriptional regulator HdfR; Provisional Back     alignment and domain information
>gnl|CDD|183045 PRK11233, PRK11233, nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|182938 PRK11062, nhaR, transcriptional activator NhaR; Provisional Back     alignment and domain information
>gnl|CDD|182999 PRK11151, PRK11151, DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>gnl|CDD|182231 PRK10086, PRK10086, DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>gnl|CDD|184959 PRK14997, PRK14997, LysR family transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|183681 PRK12684, PRK12684, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|182768 PRK10837, PRK10837, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|183680 PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|131091 TIGR02036, dsdC, D-serine deaminase transcriptional activator Back     alignment and domain information
>gnl|CDD|177082 CHL00180, rbcR, LysR transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|182077 PRK09791, PRK09791, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|183288 PRK11716, PRK11716, DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>gnl|CDD|182391 PRK10341, PRK10341, DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>gnl|CDD|183678 PRK12681, cysB, transcriptional regulator CysB; Reviewed Back     alignment and domain information
>gnl|CDD|182899 PRK11013, PRK11013, DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>gnl|CDD|185319 PRK15421, PRK15421, DNA-binding transcriptional regulator MetR; Provisional Back     alignment and domain information
>gnl|CDD|183677 PRK12680, PRK12680, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|182228 PRK10082, PRK10082, cell density-dependent motility repressor; Provisional Back     alignment and domain information
>gnl|CDD|179616 PRK03635, PRK03635, chromosome replication initiation inhibitor protein; Validated Back     alignment and domain information
>gnl|CDD|185155 PRK15243, PRK15243, transcriptional regulator SpvR; Provisional Back     alignment and domain information
>gnl|CDD|176107 cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 299 putative transcription regulator protein [Candidatus Li
PRK10632309 putative DNA-binding transcriptional regulator; Provisi 100.0
TIGR03418291 chol_sulf_TF putative choline sulfate-utilization trans 100.0
PRK09801310 transcriptional activator TtdR; Provisional 100.0
PRK12684313 transcriptional regulator CysB-like protein; Reviewed 100.0
PRK11242292 DNA-binding transcriptional regulator CynR; Provisional 100.0
PRK11139295 DNA-binding transcriptional activator GcvA; Provisional 100.0
PRK11013309 DNA-binding transcriptional regulator LysR; Provisional 100.0
CHL00180307 rbcR LysR transcriptional regulator; Provisional 100.0
PRK12682309 transcriptional regulator CysB-like protein; Reviewed 100.0
PRK10086311 DNA-binding transcriptional regulator DsdC; Provisional 100.0
PRK12683308 transcriptional regulator CysB-like protein; Reviewed 100.0
PRK10837291 putative DNA-binding transcriptional regulator; Provisi 100.0
PRK11151305 DNA-binding transcriptional regulator OxyR; Provisional 100.0
PRK09791302 putative DNA-binding transcriptional regulator; Provisi 100.0
PRK11233305 nitrogen assimilation transcriptional regulator; Provis 100.0
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 100.0
PRK09906296 DNA-binding transcriptional regulator HcaR; Provisional 100.0
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associated Ly 100.0
PRK12681324 cysB transcriptional regulator CysB; Reviewed 100.0
PRK11074300 putative DNA-binding transcriptional regulator; Provisi 100.0
PRK10341312 DNA-binding transcriptional activator TdcA; Provisional 100.0
TIGR03298292 argP transcriptional regulator, ArgP family. ArgP used 100.0
PRK12680327 transcriptional regulator CysB-like protein; Reviewed 100.0
PRK10094308 DNA-binding transcriptional activator AllS; Provisional 100.0
PRK13348294 chromosome replication initiation inhibitor protein; Pr 100.0
PRK03635295 chromosome replication initiation inhibitor protein; Va 100.0
PRK03601275 transcriptional regulator HdfR; Provisional 100.0
PRK09986278 DNA-binding transcriptional activator XapR; Provisional 100.0
PRK10082303 putative DNA-binding transcriptional regulator; Provisi 100.0
PRK09508314 leuO leucine transcriptional activator; Reviewed 100.0
COG0583297 LysR Transcriptional regulator [Transcription] 100.0
PRK11716269 DNA-binding transcriptional regulator IlvY; Provisional 100.0
PRK11062296 nhaR transcriptional activator NhaR; Provisional 100.0
TIGR02424300 TF_pcaQ pca operon transcription factor PcaQ; InterPro: 100.0
TIGR02036302 dsdC D-serine deaminase transcriptional activator; Inte 100.0
PRK11482266 putative DNA-binding transcriptional regulator; Provisi 100.0
PRK10216288 DNA-binding transcriptional regulator YidZ; Provisional 100.0
pfam03466209 LysR_substrate LysR substrate binding domain. The struc 99.97
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 97.27
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 96.92
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 95.7
COG2998280 TupB ABC-type tungstate transport system, permease comp 95.64
pfam00497224 SBP_bac_3 Bacterial extracellular solute-binding protei 95.59
smart00062219 PBPb Bacterial periplasmic substrate-binding proteins. 95.18
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 94.86
PRK11260264 cystine transporter subunit; Provisional 94.19
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 91.36
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 91.28
COG0226318 PstS ABC-type phosphate transport system, periplasmic c 90.18
pfam0012660 HTH_1 Bacterial regulatory helix-turn-helix protein, ly 99.78
PRK10676262 DNA-binding transcriptional regulator ModE; Provisional 98.42
COG2005130 ModE N-terminal domain of molybdenum-binding protein [G 98.3
PRK11050155 manganese transport regulator MntR; Provisional 97.45
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 97.32
PRK03902142 manganese transport transcriptional regulator; Provisio 97.19
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 96.9
COG1846126 MarR Transcriptional regulators [Transcription] 96.84
COG1321154 TroR Mn-dependent transcriptional regulator [Transcript 96.78
PRK03573144 transcriptional regulator SlyA; Provisional 96.78
TIGR00637101 ModE_repress ModE molybdate transport repressor domain; 96.7
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 96.4
pfam0904858 Cro Cro. Members of this family are involved in the rep 96.31
PRK11169164 leucine-responsive transcriptional regulator; Provision 96.08
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 95.9
PRK10141106 DNA-binding transcriptional repressor ArsR; Provisional 95.88
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 95.87
PRK11886319 biotin--protein ligase; Provisional 95.79
pfam0102247 HTH_5 Bacterial regulatory protein, arsR family. Member 95.5
PRK11179153 DNA-binding transcriptional regulator AsnC; Provisional 95.47
COG4742260 Predicted transcriptional regulator [Transcription] 95.32
COG1522154 Lrp Transcriptional regulators [Transcription] 95.09
pfam0104759 MarR MarR family. The Mar proteins are involved in the 94.83
COG165479 BirA Biotin operon repressor [Transcription] 94.78
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 94.47
pfam0132558 Fe_dep_repress Iron dependent repressor, N-terminal DNA 94.39
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon 94.0
COG2522119 Predicted transcriptional regulator [General function p 93.8
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 93.28
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 93.02
pfam0496753 HTH_10 HTH DNA binding domain. 92.88
PRK10870176 transcriptional repressor MprA; Provisional 92.66
pfam0295442 HTH_8 Bacterial regulatory protein, Fis family. 92.58
pfam0019658 GerE Bacterial regulatory proteins, luxR family. 92.54
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (ac 92.36
pfam0163890 HxlR HxlR-like helix-turn-helix. HxlR, a member of this 92.01
TIGR0260781 antidote_HigA addiction module antidote protein, HigA f 91.95
COG4189308 Predicted transcriptional regulator [Transcription] 91.81
PRK04217110 hypothetical protein; Provisional 91.21
PRK09775 443 hypothetical protein; Provisional 91.01
PRK0974475 DNA-binding transcriptional regulator DicC; Provisional 90.55
TIGR02702215 SufR_cyano iron-sulfur cluster biosynthesis transcripti 93.29
COG1910223 Periplasmic molybdate-binding protein/domain [Inorganic 92.55
PRK10859 507 putative transglycosylase; Provisional 92.19
PRK10651216 transcriptional regulator NarL; Provisional 91.93
PRK10403215 transcriptional regulator NarP; Provisional 90.17
PRK04168336 hypothetical protein; Provisional 91.73
>PRK10632 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor Back     alignment and domain information
>PRK09801 transcriptional activator TtdR; Provisional Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>TIGR03298 argP transcriptional regulator, ArgP family Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK10094 DNA-binding transcriptional activator AllS; Provisional Back     alignment and domain information
>PRK13348 chromosome replication initiation inhibitor protein; Provisional Back     alignment and domain information
>PRK03635 chromosome replication initiation inhibitor protein; Validated Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>PRK10082 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>COG0583 LysR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>PRK11062 nhaR transcriptional activator NhaR; Provisional Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ; InterPro: IPR012787 Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate Back     alignment and domain information
>TIGR02036 dsdC D-serine deaminase transcriptional activator; InterPro: IPR011781 This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA Back     alignment and domain information
>PRK11482 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK10216 DNA-binding transcriptional regulator YidZ; Provisional Back     alignment and domain information
>pfam03466 LysR_substrate LysR substrate binding domain Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>pfam00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family Back     alignment and domain information
>PRK10676 DNA-binding transcriptional regulator ModE; Provisional Back     alignment and domain information
>COG2005 ModE N-terminal domain of molybdenum-binding protein [General function prediction only] Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>TIGR00637 ModE_repress ModE molybdate transport repressor domain; InterPro: IPR003725 Molybdenum-dependent repression of transcription of the Escherichia coli modABCD operon, which encodes the high-affinity molybdate transporter, is mediated by the ModE protein Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>pfam09048 Cro Cro Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>pfam01022 HTH_5 Bacterial regulatory protein, arsR family Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>pfam01047 MarR MarR family Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>pfam01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>pfam04967 HTH_10 HTH DNA binding domain Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>pfam02954 HTH_8 Bacterial regulatory protein, Fis family Back     alignment and domain information
>pfam00196 GerE Bacterial regulatory proteins, luxR family Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>pfam01638 HxlR HxlR-like helix-turn-helix Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK09775 hypothetical protein; Provisional Back     alignment and domain information
>PRK09744 DNA-binding transcriptional regulator DicC; Provisional Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR; InterPro: IPR014075 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10859 putative transglycosylase; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target299 putative transcription regulator protein [Candidatus Li
3hhg_A306 Structure Of Crga, A Lysr-Type Transcriptional Regu 2e-38
3mz1_A300 The Crystal Structure Of A Possible Transcription R 1e-36
>gi|251836996|pdb|3HHG|A Chain A, Structure Of Crga, A Lysr-Type Transcriptional Regulator From Neisseria Meningitidis. Length = 306 Back     alignment and structure
 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/298 (24%), Positives = 129/298 (43%), Gaps = 9/298 (3%)

Query: 1   MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLT 60
           M  + ++L VF  V  SGSF+ AAEQL ++ S++SR +  LE ++G+ L  R  R L+LT
Sbjct: 1   MKTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLT 60

Query: 61  EQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYP 120
           E+G++  R    +  ++   + E+      P G L + + + +  +LL     +F   YP
Sbjct: 61  EEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYP 120

Query: 121 DIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREP 180
            I++ L+     I++     D A+R    +  S L  R L        A+P YL     P
Sbjct: 121 HIRLSLVSSEGYINLIERKVDIALRAG-ELDDSGLRARHLFDSRFRVIASPEYLAKHGTP 179

Query: 181 LSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSG 240
            S +EL  H  + F +          W     +            +S   +   C+ G G
Sbjct: 180 QSTEELAGHQCLGFTEP----GSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCG 235

Query: 241 IALLPDYIVKDN---PNLVRIMEDVITP-SFTVYFCYPEALKNTGKLKAFRNFIFLKA 294
           I  L D++V ++     L+ ++ +  +  +      Y        +L+ F +F+  + 
Sbjct: 236 IVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEEL 293


>gi|297343178|pdb|3MZ1|A Chain A, The Crystal Structure Of A Possible Transcription Regulator From Sinorhizobium Meliloti 1021 Length = 300 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target299 putative transcription regulator protein [Candidatus Li
3mz1_A300 Putative transcriptional regulator; structural genomics 6e-53
3hhg_A306 Transcriptional regulator, LYSR family; transcription f 1e-46
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha helix co 1e-36
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 2e-36
3isp_A303 HTH-type transcriptional regulator RV1985C/MT2039; ROD 2e-33
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 5e-33
1uth_A315 LYSR-type regulatory protein; transcription regulation, 3e-31
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 5e-31
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, transcri 5e-30
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTTR; 1. 3e-28
2esn_A310 Probable transcriptional regulator; PA0477, APC5828,tra 1e-26
3hhf_B213 Transcriptional regulator, LYSR family; transcription f 4e-24
3kos_A219 HTH-type transcriptional activator AMPR; alpha-beta san 1e-21
3fd3_A208 Chromosome replication initiation inhibitor protein; st 1e-18
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 3e-15
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 5e-14
2qsx_A218 Putative transcriptional regulator, LYSR family; the pu 6e-14
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 5e-13
2ql3_A209 Probable transcriptional regulator, LYSR family protein 2e-12
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 1e-08
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 2e-05
1b9m_A265 Protein (mode); DNA-binding, gene regulation, winged he 3e-16
3cta_A230 Riboflavin kinase; structural genomics, transferase, PS 9e-06
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional repress 5e-13
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 8e-04
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR transcrip 4e-09
>3mz1_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative, MI center for STR uctural genomics, MCSG; 1.88A {Sinorhizobium meliloti} Length = 300 Back     alignment and structure
 Score =  203 bits (516), Expect = 6e-53
 Identities = 67/286 (23%), Positives = 126/286 (44%), Gaps = 4/286 (1%)

Query: 8   LRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLH 67
           +R F  V  +G+FT A+  L++ +++++  I GLE  +  KL  R  R + +T  G+  +
Sbjct: 3   MRAFLRVVETGNFTRASASLNMPKATVTNLIQGLEAHLRTKLLNRTTRRVLVTPDGALYY 62

Query: 68  RVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLI 127
              + +   L+     L  +   P G+LR+ T       ++   L EF   YPDIQI L 
Sbjct: 63  ERAARLLSDLDELDGSLSTAQSLPKGRLRVETASAFANLVIIPALPEFHKKYPDIQIDLG 122

Query: 128 LDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELD 187
           + ++ ID   +  DCAIR    +   SLI R++  +   A A+  +L+    P    +L+
Sbjct: 123 VSDRTIDYLAENVDCAIRAG-TLTDQSLIARRITEMKFVACASRDFLERHPVPQHPSDLE 181

Query: 188 KHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDY 247
           K+  +    L     +        +  I       +  N   + +     G G+   P +
Sbjct: 182 KNCYVVGYFLPKTGQQMPFHFRRGNEEIEVSGRYTMAANESTTYLAAARAGLGVIQAPLF 241

Query: 248 IVKD---NPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFI 290
           +V++   N  +V ++ D       +Y  YP     + +L+ F +++
Sbjct: 242 MVREDLRNGTMVPVLPDWQVEPMPIYLVYPPNRHLSSRLRVFADWV 287


>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structural genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B} Length = 306 Back     alignment and structure
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domains, DNA binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Length = 294 Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- binding, plasmid, transcription; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A Length = 305 Back     alignment and structure
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} Length = 303 Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Length = 306 Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Length = 315 Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Length = 324 Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcriptional regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Length = 312 Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* Length = 313 Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein structure initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Length = 310 Back     alignment and structure
>3hhf_B Transcriptional regulator, LYSR family; transcription factor, structural genomics, oxford protein production facility, OPPF; 2.30A {Neisseria meningitidis serogroup B} Length = 213 Back     alignment and structure
>3kos_A HTH-type transcriptional activator AMPR; alpha-beta sandwich, DNA-binding, transcription regulation; HET: MES; 1.83A {Citrobacter freundii} PDB: 3kot_A Length = 219 Back     alignment and structure
>3fd3_A Chromosome replication initiation inhibitor protein; structural genomics, LYSR, PSI-2, protein structure initiative; HET: MSE P33 PG4; 1.70A {Agrobacterium tumefaciens str} Length = 208 Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Length = 219 Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Length = 219 Back     alignment and structure
>2qsx_A Putative transcriptional regulator, LYSR family; the putative transcriptional regulator, PSI-2; 1.64A {Vibrio parahaemolyticus rimd 2210633} Length = 218 Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Length = 232 Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP} Length = 209 Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding domain, cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Length = 228 Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Length = 241 Back     alignment and structure
>1b9m_A Protein (mode); DNA-binding, gene regulation, winged helix turn helix, molybdate, OB fold; 1.75A {Escherichia coli} SCOP: a.4.5.8 b.40.6.2 b.40.6.2 PDB: 1b9n_A 1o7l_A 1h9s_A 1h9r_A 1h9s_B Length = 265 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Length = 230 Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural genomics, DNA-binding protein, PSI-2; 2.30A {Agrobacterium tumefaciens str} Length = 135 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Length = 244 Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR structural genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli K12} PDB: 3hfu_A Length = 238 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target299 putative transcription regulator protein [Candidatus Li
3hhg_A306 Transcriptional regulator, LYSR family; transcription f 100.0
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 100.0
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha helix co 100.0
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 100.0
3mz1_A300 Putative transcriptional regulator; structural genomics 100.0
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 100.0
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTTR; 1. 100.0
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, transcri 100.0
2esn_A310 Probable transcriptional regulator; PA0477, APC5828,tra 100.0
1uth_A315 LYSR-type regulatory protein; transcription regulation, 100.0
3isp_A303 HTH-type transcriptional regulator RV1985C/MT2039; ROD 100.0
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR transcrip 100.0
2qsx_A218 Putative transcriptional regulator, LYSR family; the pu 99.97
3kos_A219 HTH-type transcriptional activator AMPR; alpha-beta san 99.97
3hhf_B213 Transcriptional regulator, LYSR family; transcription f 99.96
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 99.96
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 99.95
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 99.95
2ql3_A209 Probable transcriptional regulator, LYSR family protein 99.93
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 99.93
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 95.45
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 93.31
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 92.64
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L-meth 90.15
1b9m_A265 Protein (mode); DNA-binding, gene regulation, winged he 99.95
3cta_A230 Riboflavin kinase; structural genomics, transferase, PS 98.38
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 99.94
3fd3_A208 Chromosome replication initiation inhibitor protein; st 99.93
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 98.59
3cvg_A294 Putative metal binding protein; PSI-II, NYSGXRC, peripl 96.45
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 95.74
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 95.32
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 94.88
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 94.34
2vha_A287 Periplasmic binding transport protein; periplasmic bind 94.33
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 94.1
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 93.47
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 93.29
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 93.03
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 92.89
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 91.55
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 90.55
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional repress 99.79
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 98.32
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 97.86
2fxa_A207 Protease production regulatory protein HPR; protease po 97.71
1y0u_A96 Arsenical resistance operon repressor, putative; struct 97.69
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; PSI- 97.62
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, DNA-b 97.58
3cjn_A162 Transcriptional regulator, MARR family; structural geno 97.57
2pex_A153 Transcriptional regulator OHRR; transcription regulator 97.47
3bj6_A152 Transcriptional regulator, MARR family; helix-turn-heli 97.42
3e6m_A161 MARR family transcriptional regulator; APC88769, silici 97.41
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix-turn 97.41
3nqo_A189 MARR-family transcriptional regulator; structural genom 97.39
3ech_A142 MEXR, multidrug resistance operon repressor; winged hel 97.37
3bpv_A138 Transcriptional regulator; MARR, DNA binding, transcrip 97.32
2fbh_A146 Transcriptional regulator PA3341; MARR, transcription r 97.32
3g3z_A145 NMB1585, transcriptional regulator, MARR family; transc 97.3
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding protein 97.3
2nyx_A168 Probable transcriptional regulatory protein, RV1404; al 97.26
2nnn_A140 Probable transcriptional regulator; structural genomics 97.21
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix-turn 97.19
3boq_A160 Transcriptional regulator, MARR family; structural geno 97.17
2fbk_A181 Transcriptional regulator, MARR family; winged-helix-tu 97.13
1z91_A147 Organic hydroperoxide resistance transcriptional regula 97.13
2qww_A154 Transcriptional regulator, MARR family; YP_013417.1, mu 97.13
3oop_A143 LIN2960 protein; protein structure initiative, PSI-2, s 97.12
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependent reg 97.08
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptional r 97.07
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, trans 97.05
2eth_A154 Transcriptional regulator, putative, MAR family; TM0816 97.01
2fa5_A162 Transcriptional regulator MARR/EMRR family; multiple an 96.97
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-turn-hel 96.95
2gxg_A146 146AA long hypothetical transcriptional regulator; wing 96.95
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix motif, wi 96.94
3kp7_A151 Transcriptional regulator TCAR; multiple drug resistanc 96.91
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; multidru 96.9
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH motif, 96.87
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, stru 96.86
3f3x_A144 Transcriptional regulator, MARR family, putative; DNA b 96.85
2ovg_A66 Phage lambda CRO; transcription factor, helix-turn-heli 96.85
1jgs_A138 Multiple antibiotic resistance protein MARR; transcript 96.84
1s3j_A155 YUSO protein; structural genomics, MARR transcriptional 96.82
2h09_A155 Transcriptional regulator MNTR; transcription regulator 96.81
3k0l_A162 Repressor protein; helix-turn-helix, structural genomic 96.76
3cdh_A155 Transcriptional regulator, MARR family; helix-turn-hlei 96.75
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, midwes 96.73
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transcripti 96.72
2frh_A127 SARA, staphylococcal accessory regulator A; winged-heli 96.7
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 96.68
3cuo_A99 Uncharacterized HTH-type transcriptional regulator YGAV 96.65
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-turn-he 96.65
3bro_A141 Transcriptional regulator; helix_TURN_helix, multiple a 96.64
2hr3_A147 Probable transcriptional regulator; MCSG, structural ge 96.61
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01047, 96.52
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, transcr 96.47
3bdd_A142 Regulatory protein MARR; putative multiple antibiotic-r 96.45
3bja_A139 Transcriptional regulator, MARR family, putative; NP_97 96.26
1p4x_A250 Staphylococcal accessory regulator A homologue; winged- 96.05
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-bindin 96.04
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MARR, st 95.94
2d1h_A109 ST1889, 109AA long hypothetical transcriptional regulat 95.75
3f6v_A151 Possible transcriptional regulator, ARSR family protein 95.66
1bia_A321 BIRA bifunctional protein; transcription regulation; 2. 95.65
2oqg_A114 Possible transcriptional regulator, ARSR family protein 95.54
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, tran 95.38
2ia2_A265 Putative transcriptional regulator; SAD, PSI-2, structu 93.8
2kko_A108 Possible transcriptional regulatory protein (possibly A 93.69
3df8_A111 Possible HXLR family transcriptional factor; APC89000, 93.39
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; DNA-b 93.32
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, APC5613 93.09
1j5y_A187 Transcriptional regulator, biotin repressor family; str 92.8
2g7u_A257 Transcriptional regulator; ICLR family, structural geno 92.65
1r7j_A95 Conserved hypothetical protein SSO10A; winged helix-tur 92.29
2o0m_A345 Transcriptional regulator, SORC family; structural geno 91.86
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn-helix 91.66
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-helix, M 91.53
2dbb_A151 Putative HTH-type transcriptional regulator PH0061; ASN 96.58
1u2w_A122 CADC repressor, cadmium efflux system accessory protein 96.24
2cfx_A144 HTH-type transcriptional regulator LRPC; transcriptiona 96.19
2ia0_A171 Putative HTH-type transcriptional regulator PF0864; ASN 96.14
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB0573, st 95.95
2e1c_A171 Putative HTH-type transcriptional regulator PH1519; DNA 95.92
2w25_A150 Probable transcriptional regulatory protein; transcript 95.76
1g2h_A61 Transcriptional regulatory protein TYRR homolog; protei 95.18
3jth_A98 Transcription activator HLYU; transcription factor, RTX 95.18
2cyy_A151 Putative HTH-type transcriptional regulator PH1519; str 94.8
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP family, 94.78
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, LRP/A 94.77
3f6o_A118 Probable transcriptional regulator, ARSR family protein 94.76
3c57_A95 Two component transcriptional regulatory protein DEVR; 94.5
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, structur 93.92
2pn6_A150 ST1022, 150AA long hypothetical transcriptional regulat 93.91
2p4w_A202 Transcriptional regulatory protein ARSR family; archaea 93.5
3i4p_A162 Transcriptional regulator, ASNC family; PSI, structural 93.38
1sfx_A109 Conserved hypothetical protein AF2008; structural genom 93.33
1je8_A82 Nitrate/nitrite response regulator protein NARL; protei 93.15
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-turn-hel 92.45
2jpc_A61 SSRB; DNA binding protein, structural genomics, PSI-2, 92.42
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA bindi 92.21
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn-helix 91.96
1z05_A429 Transcriptional regulator, ROK family; structural genom 91.93
2krf_A73 Transcriptional regulatory protein COMA; activator, com 91.8
1z6r_A406 MLC protein; transcriptional repressor, ROK family prot 91.73
3e7l_A63 Transcriptional regulator (NTR