254780283

254780283

thioredoxin reductase (NADPH) protein

GeneID in NCBI database:8209265Locus tag:CLIBASIA_00840
Protein GI in NCBI database:254780283Protein Accession:YP_003064696.1
Gene range:-(170035, 171000)Protein Length:321aa
Gene description:thioredoxin reductase (NADPH) protein
COG prediction:[O] Thioredoxin reductase
KEGG prediction:thioredoxin reductase (NADPH) protein; K00384 thioredoxin reductase (NADPH) [EC:1.8.1.9]
SEED prediction:Thioredoxin reductase (EC 1.8.1.9)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:pyrimidine conversions;
Thioredoxin-disulfide reductase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
cccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEccccccEEEEEccccEEEEEEEEEEEccccccccccccccccccEEEEEccccccHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHcccEEEEcccEEEEEEccccEEEcccccEEEEEEcccccEEEEEccEEEEcccccccHHHHHcccEEEccccEEEccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccc
cEEEEEEEEEEcccHHHHHHHHHHHccccccEEEcccccccHHHHccEcccccccccccEHHHHHHHHHHHHHHcccEEEcccEEEEEcccccEEEEEcccEEEEEEEEEEcccEEEcccccHHHHHHEcccEEccHHHHHHHHcccEEEEEccEHHHHHHHHHHcccccEEEEEEcccccEccHHHHHHHHccccEEEEccEEEEEEEEccccccccccEEEEEEEEcccccEEEEEccEEEEcccEEEccHHHcccccEcccccEcccccccEcccccEEEcHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
mashdskiliigsgpagYTAAIYAARAMLKPVIIagsdlggqLMITESienypgfatsIRGDWLMEQMRQQAENFGTKIIQDLVvsvdldrhpflvetqsgdlwhADAVVIATGSEVKWLRLESEKkfqgfgvsacatcdgffyknkdviVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQsnidflfdtevvdvigsipepplfpsvsgvrlhnkkegnffernVDGIFiaigykpntkIFRHQLKMTNtnyiwtmpdstatsipgifaagdvADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLvetqsgdlwhADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVhrrsslrsekilQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
MASHDSKILIIGSGPagytaaiyaaraMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQaitaaamgcmaaLEVEHYLSIHQSSIT
****DSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHY*********
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT
MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target321 thioredoxin reductase (NADPH) protein [Candidatus Liber
254780675 481 dihydrolipoamide dehydrogenase [Candidatus Liberib 2e-04
254780842 384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidat 0.009
>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 8  ILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGG 41
          I++IGSGPAGY AAI AA+   K  I+  + LGG
Sbjct: 7  IILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGG 40

>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 32.7 bits (73), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 8/79 (10%)

Query: 148 DVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVD 207
           DVI++G G   +  A+  AK      +V  RS L+    L+  + +   IDFL +  V D
Sbjct: 5   DVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQD---LRTTMLMGEGIDFLKEINVWD 61

Query: 208 VIGSIPEPPLFPSVSGVRL 226
            +  I EP     VS  RL
Sbjct: 62  FLQDIAEP-----VSSFRL 75

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target321 thioredoxin reductase (NADPH) protein [Candidatus Liber
315122843321 thioredoxin reductase (NADPH) protein [Candidatus Liber 1 1e-153
325293545324 Thioredoxin reductase [Agrobacterium sp. H13-3] Length 1 1e-118
159185092324 thioredoxin reductase [Agrobacterium tumefaciens str. C 1 1e-118
86358577324 thioredoxin reductase (NADPH) protein [Rhizobium etli C 1 1e-118
190892726324 thioredoxin reductase (NADPH) protein [Rhizobium etli C 1 1e-118
222086561324 thioredoxin-disulfide reductase [Agrobacterium radiobac 1 1e-118
116253170324 thioredoxin reductase [Rhizobium leguminosarum bv. vici 1 1e-117
209550301324 thioredoxin reductase [Rhizobium leguminosarum bv. trif 1 1e-116
241205684324 thioredoxin reductase [Rhizobium leguminosarum bv. trif 1 1e-115
222149304338 thioredoxin-disulfide reductase [Agrobacterium vitis S4 1 1e-114
>gi|315122843|ref|YP_004063332.1| thioredoxin reductase (NADPH) protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 321 Back     alignment and organism information
 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/321 (79%), Positives = 294/321 (91%)

Query: 1   MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMITESIENYPGFATSIR 60
           MA HDSKILIIGSGPAGYTA+IYAARAML+PVII+GS++GGQL+ITESIENYPGFA+ IR
Sbjct: 1   MAFHDSKILIIGSGPAGYTASIYAARAMLEPVIISGSEVGGQLLITESIENYPGFASPIR 60

Query: 61  GDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLWHADAVVIATGSEVKWL 120
           GDWLMEQMR QAE+FG KII DLVVSV+LD+ PF +ET+ GD+W ++AV+IATGS+VKWL
Sbjct: 61  GDWLMEQMRLQAESFGVKIINDLVVSVNLDQRPFTIETELGDVWRSEAVIIATGSKVKWL 120

Query: 121 RLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEALHLAKIARRVTIVHRRSS 180
            LESE+ FQGFGVSACATCDGFFYK+K+VIVVGGGNTAAEEALHL+KIAR+VT+VHR  S
Sbjct: 121 GLESEQTFQGFGVSACATCDGFFYKDKEVIVVGGGNTAAEEALHLSKIARKVTLVHRSLS 180

Query: 181 LRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVSGVRLHNKKEGNFFERNVD 240
           LRSEKI+QEKLF QSNIDFLF+TEVVD+IGSIP PPLFPSVSGVRLH+KK+   FE   D
Sbjct: 181 LRSEKIIQEKLFAQSNIDFLFNTEVVDIIGSIPTPPLFPSVSGVRLHSKKDKTVFEIPAD 240

Query: 241 GIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGIFAAGDVADERYRQAITAAA 300
           GIFIAIGYKPNT IFRH+LKMT+T+YIWT P+STATS+PG+FA+GDV D+ YRQAITAA+
Sbjct: 241 GIFIAIGYKPNTDIFRHKLKMTDTDYIWTAPNSTATSVPGVFASGDVTDDHYRQAITAAS 300

Query: 301 MGCMAALEVEHYLSIHQSSIT 321
           MGCMAALE E+YLSIHQ S++
Sbjct: 301 MGCMAALEAENYLSIHQGSVS 321


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293545|ref|YP_004279409.1| Thioredoxin reductase [Agrobacterium sp. H13-3] Length = 324 Back     alignment and organism information
>gi|159185092|ref|NP_355146.2| thioredoxin reductase [Agrobacterium tumefaciens str. C58] Length = 324 Back     alignment and organism information
>gi|86358577|ref|YP_470469.1| thioredoxin reductase (NADPH) protein [Rhizobium etli CFN 42] Length = 324 Back     alignment and organism information
>gi|190892726|ref|YP_001979268.1| thioredoxin reductase (NADPH) protein [Rhizobium etli CIAT 652] Length = 324 Back     alignment and organism information
>gi|222086561|ref|YP_002545095.1| thioredoxin-disulfide reductase [Agrobacterium radiobacter K84] Length = 324 Back     alignment and organism information
>gi|116253170|ref|YP_769008.1| thioredoxin reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 324 Back     alignment and organism information
>gi|209550301|ref|YP_002282218.1| thioredoxin reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 324 Back     alignment and organism information
>gi|241205684|ref|YP_002976780.1| thioredoxin reductase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 324 Back     alignment and organism information
>gi|222149304|ref|YP_002550261.1| thioredoxin-disulfide reductase [Agrobacterium vitis S4] Length = 338 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target321 thioredoxin reductase (NADPH) protein [Candidatus Liber
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 1e-115
KOG0404322 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Postt 1e-84
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisional 1e-78
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 3e-62
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 3e-50
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 2e-48
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 5e-46
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 9e-45
COG1249 454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 2e-18
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenase sub 5e-17
PRK06292 460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 7e-16
COG0446 415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 2e-14
KOG1336478 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredo 2e-13
TIGR01350 461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 1e-12
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in K+ tr 2e-12
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provisiona 2e-12
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase beta 3e-12
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homotetram 4e-11
PRK06912 458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validat 5e-11
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; Review 8e-11
PRK12814 652 PRK12814, PRK12814, putative NADPH-dependent glutamate 3e-09
TIGR02053 463 TIGR02053, MerA, mercuric reductase 5e-09
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase subunit 3e-08
KOG1335 506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 4e-08
PRK12771 564 PRK12771, PRK12771, putative glutamate synthase (NADPH) 5e-08
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, YgfK s 1e-07
PRK06370 463 PRK06370, PRK06370, mercuric reductase; Validated 1e-07
PRK12770352 PRK12770, PRK12770, putative glutamate synthase subunit 2e-07
PRK06116 450 PRK06116, PRK06116, glutathione reductase; Validated 5e-07
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyprenyl 5e-07
KOG4716 503 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Postt 1e-06
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy produc 2e-06
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase 3e-06
PRK05249 461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-06
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADP 4e-06
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing subuni 6e-06
TIGR01438 484 TIGR01438, TGR, thioredoxin and glutathione reductase s 4e-05
PRK07845 466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 7e-05
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase small sub 6e-04
TIGR01421 450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 9e-04
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 3e-88
TIGR03385 427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-11
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polyprenylp 7e-11
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamate syn 1e-09
PRK09564 444 PRK09564, PRK09564, coenzyme A disulfide reductase; Rev 3e-07
PRK13748 561 PRK13748, PRK13748, putative mercuric reductase; Provis 3e-04
PRK07251 438 PRK07251, PRK07251, pyridine nucleotide-disulfide oxido 0.001
PRK14694 468 PRK14694, PRK14694, putative mercuric reductase; Provis 0.004
KOG1399448 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygen 2e-09
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide ox 2e-08
PRK13512 438 PRK13512, PRK13512, coenzyme A disulfide reductase; Pro 5e-07
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], 2e-05
KOG0405 478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 5e-05
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide 6e-07
PRK06416 462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 9e-05
PRK05976 472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 4e-04
PRK06115 466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 0.001
PRK05329 422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 0.002
PRK07233 434 PRK07233, PRK07233, hypothetical protein; Provisional 0.003
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 1e-04
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 0.002
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 0.002
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 0.002
TIGR03452 452 TIGR03452, mycothione_red, mycothione reductase 0.004
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183296 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|30839 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183763 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|182113 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183735 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|183734 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|180410 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31443 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162359 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|183739 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|173157 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|36613 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|143852 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|180899 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161797 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 321 thioredoxin reductase (NADPH) protein [Candidatus Liber
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 100.0
KOG0404322 consensus 100.0
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 100.0
TIGR01350 481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 100.0
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK11749460 putative oxidoreductase; Provisional 100.0
PRK12770350 putative glutamate synthase subunit beta; Provisional 100.0
PRK06370 459 mercuric reductase; Validated 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
PRK05249 465 soluble pyridine nucleotide transhydrogenase; Provision 100.0
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 100.0
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 100.0
PRK06116 450 glutathione reductase; Validated 100.0
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 100.0
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 100.0
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 100.0
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK07818 467 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05976 464 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 100.0
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 100.0
PRK13748 561 putative mercuric reductase; Provisional 100.0
PRK06467 472 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK13984604 putative oxidoreductase; Provisional 100.0
PRK07845 467 flavoprotein disulfide reductase; Reviewed 100.0
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 100.0
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 100.0
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 100.0
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK09564 443 coenzyme A disulfide reductase; Reviewed 100.0
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 100.0
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR02053 494 MerA mercuric reductase; InterPro: IPR011796 This entry 100.0
PTZ00052 541 thioredoxin reductase; Provisional 100.0
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 100.0
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 100.0
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 100.0
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a gluta 100.0
PRK07846 453 mycothione/glutathione reductase; Reviewed 100.0
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 100.0
TIGR01421 475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 100.0
PRK13512 438 coenzyme A disulfide reductase; Provisional 100.0
PRK04965378 nitric oxide reductase; Provisional 100.0
PTZ00153 673 lipoamide dehydrogenase; Provisional 100.0
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 100.0
TIGR01438 513 TGR thioredoxin and glutathione reductase; InterPro: IP 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 100.0
TIGR01424 478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 100.0
KOG0405 478 consensus 100.0
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 100.0
KOG1335 506 consensus 100.0
KOG4716 503 consensus 100.0
KOG1336478 consensus 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 100.0
PTZ00318 514 NADH dehydrogenase; Provisional 100.0
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 100.0
KOG03992142 consensus 99.98
KOG2495491 consensus 99.93
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.93
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.93
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase; InterP 99.89
KOG1800468 consensus 99.76
KOG2755334 consensus 99.75
KOG1346 659 consensus 99.74
KOG3851446 consensus 99.72
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 99.68
PTZ00188506 adrenodoxin reductase; Provisional 99.68
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 99.43
TIGR01816 615 sdhA_forward succinate dehydrogenase, flavoprotein subu 99.25
TIGR01812 636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 99.14
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 99.08
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 100.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 99.95
KOG1399448 consensus 99.94
COG4529 474 Uncharacterized protein conserved in bacteria [Function 99.04
PRK09897 535 hypothetical protein; Provisional 98.85
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain and 97.87
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 99.81
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.68
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 92.96
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.76
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.73
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.68
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.67
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.66
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.65
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.63
PRK07804 533 L-aspartate oxidase; Provisional 99.62
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.61
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 99.61
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.59
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 99.54
PRK09077 535 L-aspartate oxidase; Provisional 99.54
PRK08071 510 L-aspartate oxidase; Provisional 99.52
PRK06854 610 adenylylsulfate reductase; Validated 99.48
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 99.4
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 99.34
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.32
PRK12842 567 putative succinate dehydrogenase; Reviewed 99.28
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.23
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 99.2
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.18
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.17
PRK08774402 consensus 99.16
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 99.16
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 99.15
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 99.14
PRK12843 576 putative FAD-binding dehydrogenase; Reviewed 99.13
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 99.12
PRK12844 552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.1
PRK07121 491 hypothetical protein; Validated 99.1
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 99.09
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.08
PRK11101 545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 99.06
PRK12845 566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.03
KOG0029 501 consensus 99.01
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.98
PRK07843 560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.97
PRK07208 474 hypothetical protein; Provisional 98.97
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.94
PRK13369 503 glycerol-3-phosphate dehydrogenase; Provisional 98.93
COG1233 487 Phytoene dehydrogenase and related proteins [Secondary 98.9
KOG2415 621 consensus 98.87
PRK07233 430 hypothetical protein; Provisional 98.85
TIGR03467 430 HpnE squalene-associated FAD-dependent desaturase. The 98.82
PRK12266 503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.76
PRK11883 452 protoporphyrinogen oxidase; Reviewed 98.75
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.75
PRK12839 574 hypothetical protein; Provisional 98.74
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.7
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.65
TIGR02734 526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.65
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.62
PRK05329 425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 98.55
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.54
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 98.54
COG3349 485 Uncharacterized conserved protein [Function unknown] 98.54
PRK08294 634 phenol 2-monooxygenase; Provisional 98.53
PRK02106 555 choline dehydrogenase; Validated 98.52
PRK12837 515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.5
KOG0685 498 consensus 98.46
TIGR02733 499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 98.41
COG1231 450 Monoamine oxidase [Amino acid transport and metabolism] 98.41
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 98.4
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 98.39
PRK12416 466 protoporphyrinogen oxidase; Provisional 98.37
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.25
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.11
pfam01593 444 Amino_oxidase Flavin containing amine oxidoreductase. T 98.09
KOG2614 420 consensus 97.97
PRK12814652 putative NADPH-dependent glutamate synthase small subun 97.96
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.96
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 97.94
COG3573 552 Predicted oxidoreductase [General function prediction o 97.9
TIGR01984 425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.87
KOG4254 561 consensus 97.85
KOG2404 477 consensus 97.84
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 97.84
KOG1276 491 consensus 97.8
COG2907 447 Predicted NAD/FAD-binding protein [General function pre 97.72
PRK13339 497 malate:quinone oxidoreductase; Reviewed 97.7
COG2303 542 BetA Choline dehydrogenase and related flavoproteins [A 97.66
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.63
KOG0042 680 consensus 97.63
pfam06039 489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 97.61
PRK098531032 putative selenate reductase subunit YgfK; Provisional 97.44
TIGR02730 506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.37
PRK05257 499 malate:quinone oxidoreductase; Validated 97.23
TIGR01989 481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 97.23
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 97.22
TIGR02731 454 phytoene_desat phytoene desaturase; InterPro: IPR014102 97.09
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 97.07
KOG2960328 consensus 96.96
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 96.92
KOG2844 856 consensus 96.83
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.77
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.75
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.68
KOG2853 509 consensus 96.63
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.56
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 96.35
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.21
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.19
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.19
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.18
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.18
KOG2665453 consensus 96.17
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 96.12
KOG3855 481 consensus 96.11
PRK13977 577 myosin-cross-reactive antigen; Provisional 96.11
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.08
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 96.06
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.97
KOG2852380 consensus 95.9
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 95.86
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.84
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 95.81
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.8
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.73
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.73
KOG3923342 consensus 95.67
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.62
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.6
KOG1238 623 consensus 95.59
PRK05335 434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.56
pfam06100 500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 95.52
pfam00996 439 GDI GDP dissociation inhibitor. 95.37
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.35
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 95.29
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.29
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.16
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 95.14
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 95.09
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.06
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.05
PRK09496 455 trkA potassium transporter peripheral membrane componen 95.01
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.92
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 94.9
PRK07660283 consensus 94.84
PRK07411390 hypothetical protein; Validated 94.83
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 94.81
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 94.71
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 94.67
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.64
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.58
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 94.47
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.45
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 94.38
PRK09117282 consensus 94.37
KOG1399448 consensus 94.3
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.22
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 94.21
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.2
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.15
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.14
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.88
PRK12862 761 malic enzyme; Reviewed 93.86
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.82
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 93.77
TIGR02279 508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 93.72
PRK05562222 precorrin-2 dehydrogenase; Provisional 93.72
PRK07232 753 malic enzyme; Reviewed 93.71
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 93.61
PRK12921306 2-dehydropantoate 2-reductase; Provisional 93.51
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.44
PTZ00188506 adrenodoxin reductase; Provisional 93.44
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 93.43
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 93.43
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 93.36
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 93.3
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 93.3
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 93.21
PRK08223287 hypothetical protein; Validated 93.15
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 93.03
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 92.87
PRK08275 554 putative oxidoreductase; Provisional 99.75
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.68
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.61
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 98.65
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.55
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.99
pfam01134391 GIDA Glucose inhibited division protein A. 96.85
PRK07208474 hypothetical protein; Provisional 96.43
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 96.06
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 95.53
PRK08274456 tricarballylate dehydrogenase; Validated 95.51
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 95.24
KOG0029501 consensus 95.01
PRK06185409 hypothetical protein; Provisional 94.73
pfam03486405 HI0933_like HI0933-like protein. 94.69
COG3349485 Uncharacterized conserved protein [Function unknown] 94.5
PRK12416466 protoporphyrinogen oxidase; Provisional 94.4
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.3
PRK10015429 hypothetical protein; Provisional 93.49
PRK10157428 putative oxidoreductase FixC; Provisional 93.38
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.33
COG2081408 Predicted flavoproteins [General function prediction on 93.29
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 92.99
PRK10157428 putative oxidoreductase FixC; Provisional 99.7
COG2081408 Predicted flavoproteins [General function prediction on 99.68
pfam03486405 HI0933_like HI0933-like protein. 99.65
PRK06263 539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.64
PRK06175433 L-aspartate oxidase; Provisional 99.64
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.64
PRK08401464 L-aspartate oxidase; Provisional 99.6
PRK10015429 hypothetical protein; Provisional 99.6
pfam01134391 GIDA Glucose inhibited division protein A. 99.59
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.58
PRK07395 556 L-aspartate oxidase; Provisional 99.55
PRK07512 507 L-aspartate oxidase; Provisional 99.5
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.47
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 99.45
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.45
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.39
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 99.38
TIGR00551 546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 99.37
PRK06847375 hypothetical protein; Provisional 99.36
PRK07190 480 hypothetical protein; Provisional 99.33
PRK09126392 hypothetical protein; Provisional 99.33
PRK06834 488 hypothetical protein; Provisional 99.32
PRK07608389 hypothetical protein; Provisional 99.32
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.31
PRK07045388 putative monooxygenase; Reviewed 99.3
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 99.29
PRK08163396 salicylate hydroxylase; Provisional 99.28
PRK04965378 nitric oxide reductase; Provisional 99.26
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 99.25
PRK06184 503 hypothetical protein; Provisional 99.25
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.24
PRK08013400 hypothetical protein; Provisional 99.24
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.23
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 99.23
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 99.23
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.23
PRK11445348 putative oxidoreductase; Provisional 99.22
PRK08274456 tricarballylate dehydrogenase; Validated 99.2
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 99.2
PRK08244 494 hypothetical protein; Provisional 99.2
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 99.2
PRK06185409 hypothetical protein; Provisional 99.2
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 99.19
PRK11728400 hypothetical protein; Provisional 99.18
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 99.16
PRK06126 545 hypothetical protein; Provisional 99.16
PRK07236386 hypothetical protein; Provisional 99.15
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 99.13
PRK07588391 hypothetical protein; Provisional 99.13
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 99.13
PRK06475400 salicylate hydroxylase; Provisional 99.12
PRK05868372 hypothetical protein; Validated 99.11
PRK06996397 hypothetical protein; Provisional 99.11
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 99.09
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 99.09
PRK06753373 hypothetical protein; Provisional 99.08
PRK07845467 flavoprotein disulfide reductase; Reviewed 99.06
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 99.06
PRK05976464 dihydrolipoamide dehydrogenase; Validated 99.05
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 99.05
PRK08132 549 hypothetical protein; Provisional 99.05
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.02
PRK13748561 putative mercuric reductase; Provisional 99.02
PRK08948392 consensus 99.0
PTZ00052541 thioredoxin reductase; Provisional 98.99
PRK09564443 coenzyme A disulfide reductase; Reviewed 98.99
PRK06116450 glutathione reductase; Validated 98.98
PRK13512438 coenzyme A disulfide reductase; Provisional 98.98
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 98.97
PRK07538413 hypothetical protein; Provisional 98.95
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.93
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 98.93
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.93
PRK07846453 mycothione/glutathione reductase; Reviewed 98.92
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 98.92
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 98.91
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 98.91
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 98.91
PRK06370459 mercuric reductase; Validated 98.9
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.89
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 98.87
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 98.85
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 98.85
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.85
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.84
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 98.84
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.82
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 98.8
COG0579429 Predicted dehydrogenase [General function prediction on 98.78
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 98.71
TIGR00137 444 gid gid protein; InterPro: IPR004417 The gid proteins a 98.7
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 98.7
KOG2820399 consensus 98.69
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 98.64
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 98.63
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 98.61
KOG2311 679 consensus 98.54
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 98.54
PTZ00318514 NADH dehydrogenase; Provisional 98.5
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.47
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 98.46
PTZ00153673 lipoamide dehydrogenase; Provisional 98.43
KOG1298509 consensus 98.39
KOG1336478 consensus 98.26
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 98.2
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 98.12
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 97.91
PRK10262321 thioredoxin reductase; Provisional 97.89
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 97.83
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.78
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 97.61
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 97.57
KOG1335506 consensus 97.53
KOG2495491 consensus 97.53
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 97.48
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 97.42
KOG1346659 consensus 97.24
KOG0405478 consensus 97.14
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 96.87
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 96.35
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 96.11
KOG4716503 consensus 95.64
TIGR00275411 TIGR00275 conserved hypothetical protein TIGR00275; Int 94.87
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 92.97
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 99.14
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 97.27
PRK11883452 protoporphyrinogen oxidase; Reviewed 95.74
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.69
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 95.16
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 95.13
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.06
PRK07121491 hypothetical protein; Validated 94.95
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 94.72
PRK07233430 hypothetical protein; Provisional 94.27
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 93.93
PRK08774402 consensus 93.79
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 93.76
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 93.69
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 93.24
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 92.93
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 92.76
TIGR01317 517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.77
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.14
PRK12810 472 gltD glutamate synthase subunit beta; Reviewed 98.11
PRK13984 604 putative oxidoreductase; Provisional 97.96
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 97.92
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.91
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 97.85
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.84
PRK11749 460 putative oxidoreductase; Provisional 97.55
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 93.59
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 92.77
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 98.63
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 98.34
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 97.97
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 96.3
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 98.5
TIGR01318 480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.07
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.51
KOG0399 2142 consensus 97.29
PRK12831 464 putative oxidoreductase; Provisional 97.93
PRK12770 350 putative glutamate synthase subunit beta; Provisional 97.67
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 97.19
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.74
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 96.2
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 95.42
TIGR02023 408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 95.17
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.15
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 94.87
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 94.71
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 94.39
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 94.11
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 93.99
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.98
COG0281432 SfcA Malic enzyme [Energy production and conversion] 93.47
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.28
PRK09496455 trkA potassium transporter peripheral membrane componen 92.75
TIGR01316 462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.89
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.3
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 94.14
PRK06126 545 hypothetical protein; Provisional 97.02
PRK06847375 hypothetical protein; Provisional 96.43
PRK05868372 hypothetical protein; Validated 96.29
PRK08163396 salicylate hydroxylase; Provisional 95.67
PRK06475400 salicylate hydroxylase; Provisional 95.62
PRK07588391 hypothetical protein; Provisional 95.58
PRK06753373 hypothetical protein; Provisional 95.57
PRK07045388 putative monooxygenase; Reviewed 95.3
PRK07236386 hypothetical protein; Provisional 95.11
PRK07538413 hypothetical protein; Provisional 94.87
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 94.75
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.61
PRK06834 488 hypothetical protein; Provisional 94.52
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 94.35
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.31
PRK08244 494 hypothetical protein; Provisional 94.3
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.24
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.13
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 94.11
PRK09126392 hypothetical protein; Provisional 93.92
PRK07608389 hypothetical protein; Provisional 93.79
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 93.65
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.59
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.34
PRK07190 480 hypothetical protein; Provisional 93.26
PRK08013400 hypothetical protein; Provisional 93.21
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.09
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 92.97
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 96.19
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 96.13
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 94.86
PRK08294 634 phenol 2-monooxygenase; Provisional 93.8
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 92.8
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase; InterPro: IPR005982 Reactive oxygen species (ROS) are known mediators of intracellular signaling cascades Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0404 consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258 These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11749 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004 One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1 Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information