254780284

254780284

hypothetical protein CLIBASIA_00845

GeneID in NCBI database:8209266Locus tag:CLIBASIA_00845
Protein GI in NCBI database:254780284Protein Accession:YP_003064697.1
Gene range:-(171395, 173266)Protein Length:623aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVSYARKKRSQRSPEDQLPSSKHLSPRFGSAHENFFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTEEILKGELTDKTDSSFSDSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKRLGSHSAIDDDLGLDFGDIEKELLSISGCANRESDSRDQEKKSSDIEKSESQGPVFDLKKIVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDRFSGEKPSSPKQKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENEDRSRSESIIVEKEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVPRSYSNRS
cccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHcccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccEEEccHHHHHccccccccccHHHHHHHHHcccHHHHHccccccEEEEccccccccccccEEEEEHHHHHccccHHccccccccHHHHHcccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHHccHHHccEEEEEcccccHHHHccccccccccccHHHHHHccccccccccccccccHHccHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEHHHHccHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHEEEEHHHcHHHHHccHHHHccccccccccEEEEEHHHccccccccccccccc
cccHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHccHHcccHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHccccccHHHHHHHHHHHHcccccccccHHHHccccccHHHHHcccccccEEEcccHHHHHHccccccccccccHHHHHHcccccHHHcccccEEEEEcccccEcccHcHccEEcHHHccccccccccEEccccccccccccccccccccccccHHHHHHHHccccccccccccHHccccccccccccccccEcHHHEEEEccccccHcHHHHHHHcccHHHccHHHHcccHHHHHHEEEccccccEEEEccccccEEEEEEEcccccccccccHHHcccccEEEEcccccccccccHHHccccHHHHHHHHHHHHHHHEEEEEccHHHHHHHccccccccccccEEEEccccccEEccccccccccccccccEEEHEcccccccccccccHHHHccccccccccccccccccccHHHHHccHHHHHHEcEEEEEccccccccccEEEEccccccccccHHHcccccccccccEHEEEHHHccccccccccccccc
MKNEKEFLDkrdasfrigqfpssipsldssIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVSYARkkrsqrspedqlpsskhlsprfgsahenffdcdlenkpfpveTVVEKKENVdkslqskpstdLLVQATSFLKEsvidypdcdseimRGLDddldrcfekkdrtsaiqLDKTEEILKgeltdktdssfsdsmakygtgmssalegkkenifladdqgislkskeDMLTLDIQslekspvddcgisltespkkrlgshsaidddlgldfgDIEKELLSIsgcanresdsrdqekkssdieksesqgpvfdlkkivrfeeypkdMDELVISSLLVDEEKLSLEKVNHSLEQDIATLsfeeggkkylfnsntegiargisinrdcslgddvhrenmfsapeisvdgfhegsslvspalksnskrdvaQNRKFWLIGYILIVVGCGIYWFFQLHReisfanekplivnaikdpmkvipssseeendtsfnQVHEVYDrfsgekpsspkqktllnlqekpidfpvqnqetshykspsiieNSIRDIQAVSQVSvaenedrsrsesiivekeipqlsqqssflmdnkenfqgvdsLQINLsklkgnipvprsysnrs
MKNEKEFLdkrdasfrigqfpssipsldssIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVSYARKkrsqrspedqlpsskhlspRFGSAHENFFDCDLENKPFPVETVVEKKenvdkslqskpstdllVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKkdrtsaiqldkteeilkgeltdktdssfsdSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQslekspvddcgisltespkkrlgshsaidddlgLDFGDIEKELLSisgcanresdsrdqekkssdieksesqgpvfdlkkiVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVspalksnskrdVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPSsseeendtsfNQVHEVYDRFsgekpsspkQKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSvaenedrsrsesiivekeipqlsqQSSFLMDNKENFQGVDSLQinlsklkgnipvprsysnrs
MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVSYARKKRSQRSPEDQLPSSKHLSPRFGSAHENFFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTEEILKGELTDKTDSSFSDSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKRLGSHSAidddlgldfgdiEKELLSISGCANRESDSRDQekkssdieksesQGPVFDLKKIVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDRFSGEKPSSPKQKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENEDRSRSESIIVEKEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVPRSYSNRS
***********DASF*I*QF************DYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFV********************************FFDCDLENKPFPVETVVEKKENVDK*LQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDR**********************************************IFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISL************AIDDDLGLDFGDIEKELLSIS****************************FDLKKIVRFEEYPKDMDELVISSLLV**********NHSLEQDIATLSF************************************************************************FWLIGYILIVVGCGIYWFFQLH***********IVNAIKDPMKV****************HEVY**************************************************************************************DNKENFQGVDSLQINLSKLKGNIP*********
MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVS********************LSPRFGSAHENFFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTEEILKGELTDKTDSSFSDSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKRLGSHSAIDDDLGLDFGDIEKELLSISGC***********************GPVFDLKKIVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIP**********FNQVHEVYDR**********QKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAV**************ESIIVEKEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVPRSYSNRS
******FLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASLGS***EK********************************ENFFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTEEILKGEL******SFSD******TGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLT**********SAIDDDLGLDFGDIEKELLSIS*************************GPVFDLKKIVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPS********SFNQVHEVYDRFSGEKPSSPKQKT***LQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENE*RSRSESIIVEKEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVP*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASLGSMGQEKFVSYARKKRSQRSPEDQLPSSKHLSPRFGSAHENFFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTEEILKGELTDKTDSSFSDSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKRLGSHSAIDDDLGLDFGDIEKELLSISGCANRESDSRDQEKKSSDIEKSESQGPVFDLKKIVRFEEYPKDMDELVISSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDRFSGEKPSSPKQKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENEDRSRSESIIVEKEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVPRSYSNRS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target623 hypothetical protein CLIBASIA_00845 [Candidatus Liberib
315122844588 hypothetical protein CKC_05500 [Candidatus Liberibacter 1 5e-97
325293095 1002 hypothetical protein AGROH133_06636 [Agrobacterium sp. 1 7e-06
159184882 1008 hypothetical protein Atu1710 [Agrobacterium tumefaciens 1 9e-06
222148974 911 hypothetical protein Avi_2674 [Agrobacterium vitis S4] 1 2e-04
222085781 929 hypothetical protein Arad_2120 [Agrobacterium radiobact 1 3e-04
163759454 1100 hypothetical protein HPDFL43_08882 [Hoeflea phototrophi 1 4e-04
150396378 966 sporulation domain-containing protein [Sinorhizobium me 1 5e-04
241204411 1079 Sporulation domain protein [Rhizobium leguminosarum bv. 1 6e-04
218461223 494 hypothetical protein RetlK5_17652 [Rhizobium etli Kim 5 1 6e-04
227821929 972 hypothetical protein NGR_c13660 [Sinorhizobium fredii N 1 9e-04
>gi|315122844|ref|YP_004063333.1| hypothetical protein CKC_05500 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 588 Back     alignment and organism information
 Score =  360 bits (923), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 246/590 (41%), Positives = 359/590 (60%), Gaps = 60/590 (10%)

Query: 1   MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKDKVFFDGLEQELLASL 60
           MK +KE LDKR+ SF+ GQ  SS+ SL+ SIK+YS+QLT+ FLKD +FFDGLE+EL++SL
Sbjct: 1   MKKKKECLDKRNDSFKQGQLHSSVSSLEPSIKEYSKQLTDSFLKDTLFFDGLERELISSL 60

Query: 61  GSMGQEKFVSYARKKRSQRSPEDQ----LPSSKHLSPRFGS---------------AHEN 101
           G +G+ K V Y RK ++Q S  DQ    L  SK++   FGS               ++E 
Sbjct: 61  GDIGKRKTVYYGRKIQNQPSTVDQSLLNLRHSKNVCSGFGSVDRPLGTPDFSALANSNEK 120

Query: 102 FFDCDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRG 161
               D++N+     T+++  E    +L++    DL + + S  K S   + + DS+I   
Sbjct: 121 LSGKDVKNQSCST-TILDTFE----TLETASDIDLRLHSGSSQKTSETRFVEYDSKITHD 175

Query: 162 LDDDLDRCFEKKDRTSAIQL---DKTEEILKGELTDKTDSS-----FSDSMAKYGTGMSS 213
           L+D LD   +K  + ++ Q    +K + ILK +L++K DSS     +   +    T  S 
Sbjct: 176 LNDKLDDYLDKSHQINSFQSIREEKQDLILKSKLSNKKDSSALPLDYLGKLENDETVASF 235

Query: 214 ALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKR-LGSHSAI 272
           + + +  ++FL + Q IS+KSK+ + +++I+S+ K   DDC +    S ++R + S   +
Sbjct: 236 SDKQRGRDVFLDNSQNISVKSKK-IPSVNIESVGKLEADDCYLFQKNSHQRRKIESDCTV 294

Query: 273 DDDLGLDFGDIEKELLSISGCANRESDSR------DQEKKSSDIEKSESQGPVFDLKKIV 326
           DDDL LD   IEKELL IS      + S       DQ+K S D +K++ +   FDLKKIV
Sbjct: 295 DDDLTLDLVGIEKELLLISNSDKVSNASMSFDEPVDQQKVSFDAQKTKEEHLFFDLKKIV 354

Query: 327 RFEEYPKDMDELVISSL-LVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIA 385
             EEYPK++++  +SSL LVDEE  S+E  N SLE++++  SFEE  KK   ++N EGI 
Sbjct: 355 DIEEYPKELEDFPVSSLSLVDEETTSVENTNLSLEKEMSAFSFEEDSKKSFPHNNFEGIE 414

Query: 386 RGISINRDCSLGDDVHRENMFSAPE--ISVDGFHEGSSLVS------------PALKSNS 431
           +G+S+N D  LG++ +  N+FS+ E  I +D  H    L S            P L+S++
Sbjct: 415 QGLSLNEDYVLGEETNDRNLFSSQESAIDIDADHHDPLLTSSTVDNHLTKDPDPLLRSST 474

Query: 432 -----KRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIP 486
                K+D   +RK  LIGYI++V+GCG YWFFQLHREI +A   P I+NA KDP+KV+P
Sbjct: 475 VENHLKKDPVNSRKLLLIGYIVLVIGCGAYWFFQLHREIDYAGRDPRIINATKDPVKVLP 534

Query: 487 SSSEEENDTSFNQVHEVYDRFSGEKPSSPKQKTLLNLQEKPIDFPVQNQE 536
            SS +END SFN+ +EVYDRFSG+KPSSPKQK LL+LQE+P++ PV N+E
Sbjct: 535 DSSVDENDASFNKGNEVYDRFSGKKPSSPKQKKLLDLQEEPMNIPVANKE 584


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293095|ref|YP_004278959.1| hypothetical protein AGROH133_06636 [Agrobacterium sp. H13-3] Length = 1002 Back     alignment and organism information
>gi|159184882|ref|NP_354698.2| hypothetical protein Atu1710 [Agrobacterium tumefaciens str. C58] Length = 1008 Back     alignment and organism information
>gi|222148974|ref|YP_002549931.1| hypothetical protein Avi_2674 [Agrobacterium vitis S4] Length = 911 Back     alignment and organism information
>gi|222085781|ref|YP_002544311.1| hypothetical protein Arad_2120 [Agrobacterium radiobacter K84] Length = 929 Back     alignment and organism information
>gi|163759454|ref|ZP_02166539.1| hypothetical protein HPDFL43_08882 [Hoeflea phototrophica DFL-43] Length = 1100 Back     alignment and organism information
>gi|150396378|ref|YP_001326845.1| sporulation domain-containing protein [Sinorhizobium medicae WSM419] Length = 966 Back     alignment and organism information
>gi|241204411|ref|YP_002975507.1| Sporulation domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1079 Back     alignment and organism information
>gi|218461223|ref|ZP_03501314.1| hypothetical protein RetlK5_17652 [Rhizobium etli Kim 5] Length = 494 Back     alignment and organism information
>gi|227821929|ref|YP_002825899.1| hypothetical protein NGR_c13660 [Sinorhizobium fredii NGR234] Length = 972 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00