254780285

254780285

arginyl-tRNA synthetase

GeneID in NCBI database:8209267Locus tag:CLIBASIA_00850
Protein GI in NCBI database:254780285Protein Accession:YP_003064698.1
Gene range:-(173322, 175082)Protein Length:586aa
Gene description:arginyl-tRNA synthetase
COG prediction:[J] Arginyl-tRNA synthetase
KEGG prediction:argS; arginyl-tRNA synthetase (EC:6.1.1.19); K01887 arginyl-tRNA synthetase [EC:6.1.1.19]
SEED prediction:Arginyl-tRNA synthetase (EC 6.1.1.19)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Arg
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580------
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS
ccHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccHHHHHHHHHHcccHHHHHHHHHHHccccccEEEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHcccccccHHHHHHHHHHHcccccEEcccccccccccccccccccccccccccccccccEEEEccccccccHHcHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHcccccHHccEEEEccEEEcccccccccccccccEEEHHHHHHHHccHHHHHHHHHcccccccEEcHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHHHHHccccHccccccEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccEEEEcccccEEEEccHHHHHHHHHHHHHccccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHcccccccHHHHHHHHHHHcccEEEEcccccccccccccccccccEEEEEccccccccEEEEEcccccEEEHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHccccccccEEEEEEEEEEccccEEEEEcccccEEEHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHccccccEHHHHHHHHHHHHHHHHHHcccccccccccHcHccHHHcccHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcc
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIvierprdcahghlstNAAMIlsrplgldplTIAELIVARikidpdvdsvFIAGKGFINLYLSPSYLRKILSSIVVSGIEYgrnligkgtKVNIEFvsanptgpmhvghcrcaVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALynndsdlpegyypgvYLKHVGKELADKYSSellnfpeekwlpivKDYSVQAMMKIIRDDLKALniqhdifiseddfhrgdpspirDIIDNLArqgyvyegilpppkskttqkcdmdrKQLLFRstmvgddvdrpllksdgsytyFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLyrdgmpikmskragdfiTLRHVVDEVGSDSVRFMMLWRknselldfdfckvkeqskenpvfYVQYAYARCRSIFRQAkdifpdldfdlfprnvipqesefdtsELQLIVHLAeyprvienatiaqepYKLAFYLYDLASvfhghwshgrenprlrFVQANNRKLTMMRLQLVHAVASIINSGLniigvespnems
mylfadfssrLKNYlkeidckikvekKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFiseddfhrgdPSPIRDIIDNLARQGYVYEGilpppkskttqkcdMDRKQLLFrstmvgddvdrpllksdgsYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSkragdfitlrHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVkeqskenpvFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSglniigvespnems
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLeavaaavsekkaQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIfpdldfdlfpRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS
*YLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPN***
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS
MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
254780802 869 leucyl-tRNA synthetase [Candidatus Liberibacter as 5e-04
254780289682 RNA polymerase sigma factor RpoD [Candidatus Liber 0.009
>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score = 37.7 bits (86), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161
           P+G +H+GH R  V+GD +A  M  SGY V
Sbjct: 45  PSGNIHMGHLRNYVIGDVVARFMRASGYSV 74

>gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Back     alignment
 Score = 33.5 bits (75), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 199 GYYPGVYL-KHVGKELADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHD 257
           G    V+L +H G+EL   + S   +FPE +W   V    V +++K IR+++K+++++  
Sbjct: 364 GIKRDVFLERHQGRELDPHWVSYAKDFPEGEWKNFVA-CEVDSILK-IRNEIKSISVETG 421

Query: 258 IFISE 262
           I ISE
Sbjct: 422 ISISE 426

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
315122845586 arginyl-tRNA synthetase [Candidatus Liberibacter solana 1 0.0
325293096585 Arginyl-tRNA synthetase [Agrobacterium sp. H13-3] Lengt 1 0.0
307317040585 arginyl-tRNA synthetase [Sinorhizobium meliloti AK83] L 1 0.0
222085780586 arginyl-tRNA synthetase [Agrobacterium radiobacter K84] 1 0.0
116251801585 arginyl-tRNA synthetase [Rhizobium leguminosarum bv. vi 1 0.0
15965276585 arginyl-tRNA synthetase [Sinorhizobium meliloti 1021] L 1 0.0
86357446585 arginyl-tRNA synthetase [Rhizobium etli CFN 42] Length 1 0.0
150396377585 arginyl-tRNA synthetase [Sinorhizobium medicae WSM419] 1 0.0
15889018585 arginyl-tRNA synthetase [Agrobacterium tumefaciens str. 1 0.0
209549083585 arginyl-tRNA synthetase [Rhizobium leguminosarum bv. tr 1 0.0
>gi|315122845|ref|YP_004063334.1| arginyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 586 Back     alignment and organism information
 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/586 (79%), Positives = 531/586 (90%)

Query: 1   MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLD 60
           M+LF DFSSR+ NY+K+ID +  +EKK LD IV+ERPR+  HGHLSTNAAMILSRPL LD
Sbjct: 1   MHLFTDFSSRMINYIKDIDFEKNIEKKYLDCIVVERPRNIMHGHLSTNAAMILSRPLSLD 60

Query: 61  PLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKG 120
           P+TIAELI+ARIK+DPDVD V I GKGFINLYLSPSYL KILS IVVSGIEYGR+LIGKG
Sbjct: 61  PITIAELIIARIKMDPDVDFVSIGGKGFINLYLSPSYLSKILSFIVVSGIEYGRSLIGKG 120

Query: 121 TKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALS 180
            KVN+E+VSANPTGPMHVGHCRCAVVGD LA+LM FSGYEVTREYYINDAGAQI+TLA S
Sbjct: 121 RKVNVEYVSANPTGPMHVGHCRCAVVGDVLANLMEFSGYEVTREYYINDAGAQIDTLAHS 180

Query: 181 VFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELLNFPEEKWLPIVKDYSVQA 240
           VF RYQQ L NND DLPEG+YPG YLK +GKEL DKY SELLNF EEKWLPIV+DY+V+A
Sbjct: 181 VFLRYQQVLDNNDFDLPEGFYPGAYLKAIGKELVDKYGSELLNFYEEKWLPIVRDYAVKA 240

Query: 241 MMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQ 300
           MM+II+DDLKALNI+HD+F+SE +FHRGD SPIRDII ++ R+GY+YEG+LP PK+K  +
Sbjct: 241 MMEIIKDDLKALNIRHDVFVSEKNFHRGDHSPIRDIIGDMGRKGYIYEGVLPAPKAKKNK 300

Query: 301 KCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDH 360
             D++ +Q+LFRSTMVGDD+DRPL KSDGSYTYFAADLAYFK KYERGFD M+YVMGSDH
Sbjct: 301 TFDINCEQILFRSTMVGDDIDRPLFKSDGSYTYFAADLAYFKYKYERGFDQMVYVMGSDH 360

Query: 361 SGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSD 420
           SGYVKRLEAVA+AV+ +K+++NVLLCELVRLYRDGMPIKMSKRAGDFITLR+VVDEVG D
Sbjct: 361 SGYVKRLEAVASAVAGEKSKVNVLLCELVRLYRDGMPIKMSKRAGDFITLRYVVDEVGCD 420

Query: 421 SVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLF 480
            VRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKD FPD+DFDLF
Sbjct: 421 PVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDFFPDIDFDLF 480

Query: 481 PRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGR 540
           P+  + Q+  +D +ELQL++HL EYPR++ENATI QEPY+LAFYL+DLASVFH HWSHGR
Sbjct: 481 PQKALSQDFAWDIAELQLVMHLLEYPRIVENATIFQEPYRLAFYLHDLASVFHSHWSHGR 540

Query: 541 ENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEMS 586
           ENPRL+F+Q +NR+LT+MRLQLV+AVAS+INSGLNIIGVESP+EMS
Sbjct: 541 ENPRLKFIQEDNRELTIMRLQLVYAVASVINSGLNIIGVESPHEMS 586


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293096|ref|YP_004278960.1| Arginyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 585 Back     alignment and organism information
>gi|307317040|ref|ZP_07596481.1| arginyl-tRNA synthetase [Sinorhizobium meliloti AK83] Length = 585 Back     alignment and organism information
>gi|222085780|ref|YP_002544310.1| arginyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 586 Back     alignment and organism information
>gi|116251801|ref|YP_767639.1| arginyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 585 Back     alignment and organism information
>gi|15965276|ref|NP_385629.1| arginyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 585 Back     alignment and organism information
>gi|86357446|ref|YP_469338.1| arginyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 585 Back     alignment and organism information
>gi|150396377|ref|YP_001326844.1| arginyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 585 Back     alignment and organism information
>gi|15889018|ref|NP_354699.1| arginyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 585 Back     alignment and organism information
>gi|209549083|ref|YP_002281000.1| arginyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 585 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
PRK01611507 PRK01611, argS, arginyl-tRNA synthetase; Reviewed 1e-148
TIGR00456566 TIGR00456, argS, arginyl-tRNA synthetase 9e-94
PRK12451562 PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed 5e-27
COG0018577 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ri 1e-135
cd00671212 cd00671, ArgRS_core, catalytic core domain of arginyl-t 2e-54
pfam00750345 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R) 2e-50
KOG1195567 KOG1195, KOG1195, KOG1195, Arginyl-tRNA synthetase [Tra 9e-31
KOG4426656 KOG4426, KOG4426, KOG4426, Arginyl-tRNA synthetase [Tra 2e-30
PLN02286576 PLN02286, PLN02286, arginine-tRNA ligase 4e-27
smart00836122 smart00836, DALR_1, DALR anticodon binding domain 1e-28
pfam05746117 pfam05746, DALR_1, DALR anticodon binding domain 1e-23
cd07956156 cd07956, Anticodon_Ia_Arg, Anticodon-binding domain of 4e-26
pfam0348584 pfam03485, Arg_tRNA_synt_N, Arginyl tRNA synthetase N t 5e-15
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 5e-04
COG0143 558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 0.001
TIGR00398 530 TIGR00398, metG, methionyl-tRNA synthetase 0.003
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 0.004
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 0.002
>gnl|CDD|179308 PRK01611, argS, arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161886 TIGR00456, argS, arginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183534 PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185675 cd00671, ArgRS_core, catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|144375 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R) Back     alignment and domain information
>gnl|CDD|36409 KOG1195, KOG1195, KOG1195, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|39627 KOG4426, KOG4426, KOG4426, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177924 PLN02286, PLN02286, arginine-tRNA ligase Back     alignment and domain information
>gnl|CDD|129069 smart00836, DALR_1, DALR anticodon binding domain Back     alignment and domain information
>gnl|CDD|147737 pfam05746, DALR_1, DALR anticodon binding domain Back     alignment and domain information
>gnl|CDD|153410 cd07956, Anticodon_Ia_Arg, Anticodon-binding domain of arginyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|146238 pfam03485, Arg_tRNA_synt_N, Arginyl tRNA synthetase N terminal domain Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 100.0
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 100.0
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 100.0
PRK12451562 arginyl-tRNA synthetase; Reviewed 100.0
KOG4426656 consensus 100.0
KOG1195567 consensus 100.0
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 99.89
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 99.73
cd00814319 MetRS_core This is the catalytic core domain of methion 99.7
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 99.65
cd00817363 ValRS_core This is the catalytic core domain of valine 99.6
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 99.6
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 99.54
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 99.17
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 98.93
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 98.81
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 98.79
cd00674354 LysRS_core_class_I This is the catalytic core domain of 98.73
cd00672213 CysRS_core This is the catalytic core domain of cystein 98.59
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 100.0
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 99.22
KOG1149524 consensus 98.65
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 98.34
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 100.0
smart00836122 DALR_1 DALR anticodon binding domain. This all alpha he 99.97
pfam05746117 DALR_1 DALR anticodon binding domain. This all alpha he 99.97
PRK01233687 glyS glycyl-tRNA synthetase subunit beta; Validated 97.63
COG0751691 GlyS Glycyl-tRNA synthetase, beta subunit [Translation, 95.23
PRK11893512 methionyl-tRNA synthetase; Reviewed 99.91
PRK12268558 methionyl-tRNA synthetase; Reviewed 99.88
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 99.65
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 99.31
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 98.98
KOG2007 586 consensus 98.76
PRK12267 644 methionyl-tRNA synthetase; Reviewed 99.85
PRK00133 666 metG methionyl-tRNA synthetase; Reviewed 99.8
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 99.62
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 99.06
PRK12418384 cysteinyl-tRNA synthetase; Provisional 99.01
PRK13208 809 valS valyl-tRNA synthetase; Reviewed 99.77
PRK05743 910 ileS isoleucyl-tRNA synthetase; Reviewed 99.56
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 98.84
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 98.7
KOG0433 937 consensus 96.05
pfam0348584 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal doma 99.71
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 99.64
PRK05729 877 valS valyl-tRNA synthetase; Reviewed 99.63
KOG0432 995 consensus 97.9
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 99.6
KOG0436578 consensus 98.96
PRK00390822 leuS leucyl-tRNA synthetase; Validated 98.45
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 96.15
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 99.55
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 98.83
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 98.71
PRK00390 822 leuS leucyl-tRNA synthetase; Validated 97.75
PRK05347556 glutaminyl-tRNA synthetase; Provisional 97.47
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 97.07
KOG0435 876 consensus 96.78
KOG0433 937 consensus 95.89
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 99.46
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 99.34
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 98.72
pfam00133 606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 99.43
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 98.74
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 98.38
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 97.94
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 97.31
TIGR00463 600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 97.29
KOG0432 995 consensus 96.52
TIGR00392 938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 95.99
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 95.46
PRK12558461 glutamyl-tRNA synthetase; Provisional 99.4
PRK12410433 glutamyl-tRNA synthetase; Provisional 99.31
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 99.1
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 93.84
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 99.12
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 98.6
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 98.44
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 98.39
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 99.06
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 98.74
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 99.0
KOG0434 1070 consensus 94.72
TIGR00467539 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 Th 92.03
KOG1147 712 consensus 92.28
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG4426 consensus Back     alignment and domain information
>KOG1195 consensus Back     alignment and domain information
>pfam00750 tRNA-synt_1d tRNA synthetases class I (R) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>cd00671 ArgRS_core This is the catalytic core domain of Arginyl tRNA synthetase (ArgRS) Back     alignment and domain information
>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain Back     alignment and domain information
>KOG1149 consensus Back     alignment and domain information
>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain Back     alignment and domain information
>cd07956 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tRNA synthetases Back     alignment and domain information
>smart00836 DALR_1 DALR anticodon binding domain Back     alignment and domain information
>pfam05746 DALR_1 DALR anticodon binding domain Back     alignment and domain information
>PRK01233 glyS glycyl-tRNA synthetase subunit beta; Validated Back     alignment and domain information
>COG0751 GlyS Glycyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2007 consensus Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>pfam03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0436 consensus Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12410 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1147 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
2zue_A629 Crystal Structure Of Pyrococcus Horikoshii Arginyl- 3e-63
1bs2_A607 Yeast Arginyl-Trna Synthetase Length = 607 2e-60
1iq0_A592 Thermus Thermophilus Arginyl-Trna Synthetase Length 1e-50
3fnr_A464 Crystal Structure Of Putative Arginyl T-Rna Synthet 1e-46
3gdz_A109 Crystal Structure Of Arginyl-Trna Synthetase From K 7e-22
gi|256032304|pdb|2ZUE|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Arginyl-Trna Synthetase Complexed With Trna(Arg) And An Atp Analog (Anp) Length = 629 Back     alignment and structure
 Score =  248 bits (632), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 132/624 (21%), Positives = 245/624 (39%), Gaps = 90/624 (14%)

Query: 31  RIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKID--PDVDSVFIAGKGF 88
            I ++   D   G   T  A  L++ L   P+ IAE IV ++K++    +  V  A  G+
Sbjct: 27  EIELKETPDPKLGDFGTPIAFKLAKLLKRPPIEIAEKIVEKLKLNLPEGIKDVK-AVNGY 85

Query: 89  INLYLS-PSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVG 147
           IN+++  P + R +++ I+  G  +G + IGKG KV +E  S NPT P+H+GH R A++G
Sbjct: 86  INVFIDYPHFARILINDILAKGDRFGSSEIGKGKKVIVEHTSVNPTKPLHMGHARNAILG 145

Query: 148 DTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLK 207
           D +A ++ F GYEV  + YI+D G Q   +    + R ++      ++L E       + 
Sbjct: 146 DVMARILRFLGYEVEVQNYIDDLGIQFAQVYWG-YLRLKEEFERIMNELRERGLKDNPID 204

Query: 208 HVGKELADKYSSELLNFP--EEKWLPIVKDYSV---------QAMMKIIRDDLKALNIQH 256
           H    L  + +  L + P  E +   I+K             + +++        L +++
Sbjct: 205 HALGLLYVEVNRRLEDNPELENEIRDIMKKLESGELYGRKLAEEVVRAQMVTTYKLGVKY 264

Query: 257 DIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMV 316
           D+ + E D  R     I   ++ L++     E    P   K      MD ++L       
Sbjct: 265 DLLVWESDIVRRKLFEI--ALELLSKN----ENFYIPSDGKYRGAFVMDLRKLFPD---- 314

Query: 317 GDDVDRPLLKSDGSYTYFAADLAYFKCKYERGFDNMIYVMGSDHSGYVK-----RLEAVA 371
             +    L +SDG+ TY   D+AY   K+ +   +++Y      +               
Sbjct: 315 MKNPILVLRRSDGTATYTGKDIAYHLWKFGKIDVDLLYKEWDSTTWTTAPDGKSMPNKFG 374

Query: 372 AAVSEKKAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWR-- 429
            A               + +      +     A +   L +   E               
Sbjct: 375 NANIVINVIGAEQKHPQLAIKYALQLLGFEDAAANLYHLAYEHVERPEGKFSGRKGTWVG 434

Query: 430 -----------------------------------------KNSELLDFDFCKVKEQ--- 445
                                                        L+ +   K       
Sbjct: 435 FTVDEVIQEAVKRARELIEEKNPALSDEEKAEVAEKVGIGAIRYNLIKYSPDKKIIFRWE 494

Query: 446 ----SKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVH 501
                +     Y+QYA+ARC SI R+A++    +D +   +N     ++    E +L++ 
Sbjct: 495 DVLNFEGESAPYIQYAHARCSSILRKAEEEGIKVDPETLFKNA--DFTKLSERERELVIM 552

Query: 502 LAEYPRVIENATIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQ 561
           L+++PR++E A    +P+ +A++  +LAS+F+  +           ++A    +   RL 
Sbjct: 553 LSKFPRIVEQAGKDVKPHLIAWFANELASLFNKFYMDH------PVLKAE-EGVREARLL 605

Query: 562 LVHAVASIINSGLNIIGVESPNEM 585
           LV AV  ++ + L ++G+E+P  M
Sbjct: 606 LVMAVEQVLKNALYLMGIEAPERM 629


gi|5821887|pdb|1BS2|A Chain A, Yeast Arginyl-Trna Synthetase Length = 607 Back     alignment and structure
gi|17942832|pdb|1IQ0|A Chain A, Thermus Thermophilus Arginyl-Trna Synthetase Length = 592 Back     alignment and structure
>gi|222143238|pdb|3FNR|A Chain A, Crystal Structure Of Putative Arginyl T-Rna Synthetase From Campylobacter Jejuni Length = 464 Back     alignment and structure
>gi|224983700|pdb|3GDZ|A Chain A, Crystal Structure Of Arginyl-Trna Synthetase From Klebsiella Pneumoniae Subsp. Pneumoniae Length = 109 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 1e-108
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 1e-103
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 1e-92
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 2e-88
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 1e-30
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 2e-10
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, protein 0.004
3gdz_A109 Arginyl-tRNA synthetase; klebsiella pneumoniae subsp. p 9e-15
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cys 5e-09
3h99_A560 Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRN 0.001
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, ross 0.004
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Length = 464 Back     alignment and structure
 Score =  387 bits (996), Expect = e-108
 Identities = 148/494 (29%), Positives = 257/494 (52%), Gaps = 41/494 (8%)

Query: 93  LSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLAS 152
           LS ++L ++ +  + +  ++ +    K     +E+VSANPTGP+H+GH R AV GDTL  
Sbjct: 3   LSKTFLNELANQALTNPNDFTKGE-KKQESFLLEYVSANPTGPLHIGHARGAVFGDTLTR 61

Query: 153 LMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKE 212
           L    GY+   EYY+NDAG QI  L LS+    ++++ + + + PE YY G Y+  + KE
Sbjct: 62  LARHLGYKFNTEYYVNDAGNQIYLLGLSILLSVKESILHENVEYPEQYYKGEYIVDLAKE 121

Query: 213 LADKYSSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSP 272
             +K+  E   F  E+ +P + D++   M+ +I+ +L+   I+ D ++SE  ++      
Sbjct: 122 AFEKFGKE---FFSEENIPSLADWAKDKMLVLIKQNLEQAKIKIDSYVSERSYYD----A 174

Query: 273 IRDIIDNLARQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYT 332
           +   +++L     +YE                   ++   S+  GD+ DR +++ DG  T
Sbjct: 175 LNATLESLKEHKGIYE----------------QEGKIWLASSQKGDEKDRVIIREDGRGT 218

Query: 333 YFAADLAYFKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLY 392
           Y AAD+ Y K K  RG+   I + G+DH GY+ R++A    +      + ++L ++V L 
Sbjct: 219 YLAADIVYHKDKMSRGYGKCINIWGADHHGYIPRMKAAMEFLGFDSNNLEIILAQMVSLL 278

Query: 393 RDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVF 452
           +DG P KMSKRAG+FI +  VVDE+GSD++R++ L +K    L+FD   ++++   NPV+
Sbjct: 279 KDGEPYKMSKRAGNFILMSDVVDEIGSDALRYIFLSKKCDTHLEFDISDLQKEDSSNPVY 338

Query: 453 YVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENA 512
           Y+ YA+AR   +F +A     D+                +   + L+        V+ +A
Sbjct: 339 YINYAHARIHQVFAKAGKKIDDVMKADL--------QSLNQDGVNLLFEALNLKAVLNDA 390

Query: 513 TIAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINS 572
             A+   K+  YL +LA+ FH  ++        + V + N       L+L   VA  I +
Sbjct: 391 FEARALQKIPDYLKNLAANFHKFYNEN------KVVGSANEND---LLKLFSLVALSIKT 441

Query: 573 GLNIIGVESPNEMS 586
             +++G+E+ N+M 
Sbjct: 442 AFSLMGIEAKNKME 455


>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Length = 607 Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Length = 592 Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Length = 629 Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Length = 523 Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Length = 414 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>3gdz_A Arginyl-tRNA synthetase; klebsiella pneumoniae subsp. pneumoniae MGH 78578, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Length = 461 Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, metal-binding, nucleotide-binding; HET: CIT; 1.40A {Escherichia coli k-12} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target586 arginyl-tRNA synthetase [Candidatus Liberibacter asiati
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 100.0
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 100.0
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 100.0
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 100.0
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA syn 99.86
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 99.9
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutam 99.4
3afh_A488 Glutamyl-tRNA synthetase 2; protein-substrate complex, 99.32
1j09_A468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken 99.27
2ja2_A498 Glutamyl-tRNA synthetase; non-discriminating glutamyl-t 99.12
3gdz_A109 Arginyl-tRNA synthetase; klebsiella pneumoniae subsp. p 99.87
3h99_A560 Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRN 99.86
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, protein 99.85
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structural gen 99.83
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A AARS 99.83
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerization, l 99.81
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 99.8
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, ross 99.71
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, metal I 99.69
1ile_A821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthe 99.51
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cys 99.61
1wkb_A810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editin 99.53
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural genomi 99.49
2v0c_A878 Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, 98.59
3al0_C592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA 99.44
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthe 98.93
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 99.25
3aii_A553 Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, l 99.01
1qtq_A553 GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, 98.75
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthet 96.75
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structu 95.98
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylatio 93.77
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, 98.71
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, 97.86
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalytic dom 95.56
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=999.14  Aligned_cols=532  Identities=23%  Similarity=0.347  Sum_probs=446.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCEEE
Q ss_conf             98689999999999999986048882122452774178801274110489998888289979999999983457897314
Q gi|254780285|r    1 MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHLSTNAAMILSRPLGLDPLTIAELIVARIKIDPDVDS   80 (586)
Q Consensus         1 M~~~~~l~~~i~~~l~~~~~~~~~~~~~~~~i~ve~p~~~~~GD~~~n~a~~lAK~~kk~P~~iA~~i~~~l~~~~~i~~   80 (586)
                      ||+.+.+++.|.+.|+++.   +++...+. ..||+|++++||||+||+||.++|  |+||++||++|+++++.++.|++
T Consensus        29 ~n~~d~~r~~i~~~l~~~~---g~~~~~~~-~~ie~p~~~~~GD~a~~~a~~~~k--~knP~~iA~~i~~~l~~~~~i~~  102 (607)
T 1f7u_A           29 VNIVDLMRNYISQELSKIS---GVDSSLIF-PALEWTNTMERGDLLIPIPRLRIK--GANPKDLAVQWAEKFPCGDFLEK  102 (607)
T ss_dssp             TCHHHHHHHHHHHHHHHHH---CCCHHHHG-GGCEECSSGGGCSEEEEGGGGCCT--TCCHHHHHHHHHHTCCCTTTEEE
T ss_pred             CCHHHHHHHHHHHHHHHHH---CCCHHHHH-HHCCCCCCCCCCCCHHHHHHHHHC--CCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             6878999999999999872---99988888-755699999885839999999966--99999999999983788786757


Q ss_pred             EEEECCCEEEEEECHHHHHH-HHHHHHHCCHHCCCCCCCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             88547976878888889999-99999856221388765655410002234432244117777785689999999985066
Q gi|254780285|r   81 VFIAGKGFINLYLSPSYLRK-ILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGY  159 (586)
Q Consensus        81 vevagpGfIN~~l~~~~~~~-~l~~i~~~~~~yG~~~~~~~~kVvVE~sSpNp~KplHVGHlRsaiIGdsi~ril~~~G~  159 (586)
                      +|++|| ||||+|+++++.+ ++.+++..+..||++..++++||+||||||||||||||||+|||+|||+|+|||+++||
T Consensus       103 vevagp-FINf~l~~~~l~~~vl~~il~~~~~~g~~~~~~~kkViVEf~SaNptkplHvGHlR~aiiGd~Lanll~~~G~  181 (607)
T 1f7u_A          103 VEANGP-FIQFFFNPQFLAKLVIPDILTRKEDYGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLANLYEKLGW  181 (607)
T ss_dssp             EEEETT-EEEEEECHHHHHHHHHHHHHHHGGGTTCCCCSSCCEEEEECCCCBTTSCCBGGGHHHHHHHHHHHHHHHHTTC
T ss_pred             EEEECC-EEEEEECHHHHHHHHHHHHHHCHHHCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             998788-7889999999999999999853031287756899879998517989988633135627999999999998799


Q ss_pred             CCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHH------------HHH---HHHHHHHHHHHCC
Q ss_conf             6410201477531455567898753222102450006601102410000------------127---8888875764134
Q gi|254780285|r  160 EVTREYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKH------------VGK---ELADKYSSELLNF  224 (586)
Q Consensus       160 ~V~r~nyvgD~G~Q~~~li~~~~~~~~~~~~~~~~~~~e~~~~~~y~~~------------~~~---e~~~~~~~~~~~~  224 (586)
                      +|+|+|||||||+|||++++++..+..+....   ..+..++...|...            ..+   +...++...+.. 
T Consensus       182 ~V~re~YinD~G~Qi~~l~~s~~~~~~~~~~~---~~~~~~l~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~-  257 (607)
T 1f7u_A          182 EVIRMNYLGDWGKQFGLLAVGFERYGNEEALV---KDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNGKAREYFKRMED-  257 (607)
T ss_dssp             EEEEEEEEBCCSHHHHHHHHHHHHHCCHHHHH---HCHHHHHHHHHHHHHHHHHHSTTSSCHHHHSSHHHHHHHHHHHH-
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHCCCCCCC---CCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHC-
T ss_conf             18885424755418899999999844545555---55412478899987775301210100334568999999997751-


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             30237999999978998875455588708752100015887301045799999999974985113426755565420002
Q gi|254780285|r  225 PEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLARQGYVYEGILPPPKSKTTQKCDM  304 (586)
Q Consensus       225 ~e~~~~~~~~~~~~~~~~~~~~~~l~~l~i~fD~~~~Es~~~~~~~~~i~~~i~~l~~~g~~~e~~~~~~~~~~~~~~~~  304 (586)
                      .+....+. |+..++++++.++++|++|||+||.|.+||+++.   ..+..+++.|+++|++++                
T Consensus       258 ~d~~~~~~-w~~~~~~s~~~~~~~~~~l~V~fD~~~~Es~~~~---~~~~~~~~~l~~~g~~~e----------------  317 (607)
T 1f7u_A          258 GDEEALKI-WKRFREFSIEKYIDTYARLNIKYDVYSGESQVSK---ESMLKAIDLFKEKGLTHE----------------  317 (607)
T ss_dssp             TCHHHHHH-HHHHHHHHHHHHHHHHHHTTCCCSEEEEGGGCCH---HHHHHHHHHHHHTTCEEE----------------
T ss_pred             CCHHHHHH-HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCC---HHHHHHHHHHHHCCCCCC----------------
T ss_conf             57999999-8766666799999998625702122221221100---006889999986598220----------------


Q ss_pred             CCCCEEEEHHHCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             478156510110222222-2102465213568889999997522-5554333677761368999999999722663-451
Q gi|254780285|r  305 DRKQLLFRSTMVGDDVDR-PLLKSDGSYTYFAADLAYFKCKYER-GFDNMIYVMGSDHSGYVKRLEAVAAAVSEKK-AQI  381 (586)
Q Consensus       305 ~~~~~~~~~~~~g~~~d~-vl~rsDGt~~Y~t~DiA~~~~k~e~-~~d~~iyVv~~~Q~~h~~~v~~~~~~lg~~~-~~~  381 (586)
                      +++++|++.+.++++.++ +++|||||+||+|+|||||++|+++ +||++|||||++|.+||+|++.+++.||++. ..+
T Consensus       318 ~~ga~~~~~~~~~~~~~~~vl~ksDGt~tY~t~DIAyh~~K~~r~~fD~~I~V~gadq~~h~~~l~~~l~~lg~~~~~~~  397 (607)
T 1f7u_A          318 DKGAVLIDLTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYEKYHFDKMIYVIASQQDLHAAQFFEILKQMGFEWAKDL  397 (607)
T ss_dssp             ETTEEEEEGGGTCTTTCEEEEECTTSCCCHHHHHHHHHHHHHHHHCCSEEEEECCGGGHHHHHHHHHHHHHTTCGGGGGE
T ss_pred             CCCCHHCCHHHHHCCCCCEEEEECCCCEEECHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             03440001154413566425881699610020088999998871077756651460365799999999998289721034


Q ss_pred             EEEECCHHHCCCCCCCCCCCCCCCCHHHHHHHHHH----------------------------HHHHHHHHHHHHHCCHH
Q ss_conf             15311011012211000001223302456777776----------------------------32112345554200012
Q gi|254780285|r  382 NVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDE----------------------------VGSDSVRFMMLWRKNSE  433 (586)
Q Consensus       382 ~~~~~~~v~l~~dg~~~kmstR~G~~v~l~dll~e----------------------------vg~~aiky~~L~~~~~~  433 (586)
                      .|+.+|++.        +||||+|++|+|+|++++                            ||++|+||++|++++.+
T Consensus       398 ~hv~~g~~~--------~mstR~G~~v~L~dll~e~~~~~~~~~~~~~~~~~~~~~~~~~a~~vg~~avr~~~l~~~~~~  469 (607)
T 1f7u_A          398 QHVNFGMVQ--------GMSTRKGTVVFLDNILEETKEKMHEVMKKNENKYAQIEHPEEVADLVGISAVMIQDMQGKRIN  469 (607)
T ss_dssp             EEECCCCEE--------SCCGGGTCCCBHHHHHHHHHHHHHHHHHTCHHHHTTCSCHHHHHHHHHHHHHHHHHHSSCTTC
T ss_pred             CEEEECCCC--------CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             134311222--------455300024338999999999999999850233103578889999972558899998604455


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33344777653202443678888888899998753320024683223422355211499899999999842189999999
Q gi|254780285|r  434 LLDFDFCKVKEQSKENPVFYVQYAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENAT  513 (586)
Q Consensus       434 ~~~Fd~d~~l~~~~~nt~~YiqYa~aR~~SIlrKa~~~~~~~~~~~~~~~~~~~~~~~~~~E~~L~~~l~~f~~vi~~a~  513 (586)
                      +|+|||++++++ +|||+|||||||||||||||||+....+.      ....+.+.+.++.|++|++.|++||++|..|+
T Consensus       470 ~~~Fd~d~~~~~-~g~t~pYvQYahARi~SIlrka~~~~~~~------~~~~d~~~L~~~~e~~L~~~L~~fp~vv~~a~  542 (607)
T 1f7u_A          470 NYEFKWERMLSF-EGDTGPYLQYAHSRLRSVERNASGITQEK------WINADFSLLKEPAAKLLIRLLGQYPDVLRNAI  542 (607)
T ss_dssp             CEECCHHHHHCC-SSSSHHHHHHHHHHHHHHHHHTTTSCHHH------HTTSCGGGCCSHHHHHHHHHHTTHHHHHHHHH
T ss_pred             CCCCCHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHCCCCCCC------CCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             544579998640-48854769999999999998720466200------14555321599999999999998999999999


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             852812799999999998899987068666665435787899999999999999999998731587985445
Q gi|254780285|r  514 IAQEPYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNIIGVESPNEM  585 (586)
Q Consensus       514 ~~~~P~~l~~Yl~~La~~Fn~fY~~~~~~~~~~v~~~~~~~~~~~RL~L~~a~~~vL~~~L~LLGI~~perM  585 (586)
                      ++++||+||.||++||++||+||++|+      |+. ++++++.+||+||.||++||++||+||||+|||||
T Consensus       543 ~~~ePh~l~~YL~~LA~~f~sfY~~~~------Vl~-~~~e~~~aRL~L~~a~~~vl~~gL~LLGI~~~erM  607 (607)
T 1f7u_A          543 KTHEPTTVVTYLFKLTHQVSSCYDVLW------VAG-QTEELATARLALYGAARQVLYNGMRLLGLTPVERM  607 (607)
T ss_dssp             HHCCHHHHHHHHHHHHHHHHHHHHHCC------STT-SCHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCSCC
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCC------CCC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             959848999999999999999870187------789-99899999999999999999998661498844669



>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure