254780300

254780300

aspartate carbamoyltransferase catalytic subunit

GeneID in NCBI database:8209282Locus tag:CLIBASIA_00925
Protein GI in NCBI database:254780300Protein Accession:YP_003064713.1
Gene range:+(190645, 191595)Protein Length:316aa
Gene description:aspartate carbamoyltransferase catalytic subunit
COG prediction:[F] Aspartate carbamoyltransferase, catalytic chain
KEGG prediction:pyrB; aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2); K00609 aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
SEED prediction:Aspartate carbamoyltransferase (EC 2.1.3.2)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
cccccccccccHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHcccEEEEEccccHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccccccEEEEEEcHHHHcccccEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHcccccEEEccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc
ccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHccccEEEEcccccccccccccEEEEEccHHHHHccccEEEEEEEEcccccHHHHHHHHHHHccccccHHHHHHccccEEEEcccccccccEEcHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHccc
mysfplynfvtvkdlsmQDVNYLLDRANeyfqkkshfnpsttrlqgLTQINLFLETSTRTQTSFEVAGKLLGVHVINIntknsamkkgENIADTIATLNAlrpniivirhpysgaVNSLmhkikgpsiinagdgthehpsQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARirviapitllpkdisnMGVEVFHDMQKGLKNVDVIMILRMQqeriprslipsireykhvYSLDEKKLKYAKKDAlvmhpgpinrnyeisssvadgSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
MYSFPLYnfvtvkdlsMQDVNYLLDRANEYFQKkshfnpsttrlqGLTQINLFLETSTRTQTSFEVAGKLLGVHVININtknsamkkgENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQqeriprslipsireyKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELlenqnkitqkel
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
***FPLYNFVTVKDLSMQDVNYLLDRANEYFQK**H*NPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININT*****KKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKE*************
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
*****LYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQN*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL
MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
255764473306 ornithine carbamoyltransferase [Candidatus Liberib 1e-13
>gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 306 Back     alignment
 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 116/277 (41%), Gaps = 38/277 (13%)

Query: 44  LQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRP 103
           L G     +F + STRT+ SFEVA K LG   I ++     + + E I DT   L+    
Sbjct: 42  LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY-V 100

Query: 104 NIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAI 163
           + IV+R      +  L      P I    D T  HP Q + D       +G +     + 
Sbjct: 101 DAIVMRTTNHSRLLELTEYATVPVINALTDNT--HPCQIIADIMTFEEHRGSVKGKLFSW 158

Query: 164 CGD---ILHSRV---ARSDIMLLNTMGARIRVIAPITLLPKD-----ISNMG--VEVFHD 210
            GD   ILHS +   AR + +L         +  PI   P++       N G  V +FHD
Sbjct: 159 SGDGNNILHSLIEGAARFNYLL--------NIATPIGSEPRNEYLNWARNQGASVALFHD 210

Query: 211 MQKGLKNVDVIM---ILRMQQERIPRSLIPSIREYKHV---YSLDEKKLKYAKKDALVMH 264
             + +K    +     + M QE   R         +HV   + ++   +  A  DAL MH
Sbjct: 211 AVQAVKGAHCVFTDTWISMNQEFKARE--------EHVFQPFQVNLSLMSMAHPDALFMH 262

Query: 265 PGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAII 301
             P +R  E+ + V DG QS++  + E  +  + AI+
Sbjct: 263 CLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
315122275316 aspartate carbamoyltransferase catalytic subunit [Candi 1 1e-143
150396159313 aspartate carbamoyltransferase catalytic subunit [Sinor 1 1e-105
15965057313 aspartate carbamoyltransferase catalytic subunit [Sinor 1 1e-105
218674771318 aspartate carbamoyltransferase catalytic subunit [Rhizo 1 1e-104
222085617318 aspartate carbamoyltransferase [Agrobacterium radiobact 1 1e-104
325292670313 aspartate carbamoyltransferase [Agrobacterium sp. H13-3 1 1e-104
209548902318 aspartate carbamoyltransferase catalytic subunit [Rhizo 1 1e-104
190891325318 aspartate carbamoyltransferase [Rhizobium etli CIAT 652 1 1e-104
241204126318 aspartate carbamoyltransferase catalytic subunit [Rhizo 1 1e-104
327190280318 aspartate carbamoyltransferase catalytic subunit [Rhizo 1 1e-104
>gi|315122275|ref|YP_004062764.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 316 Back     alignment and organism information
 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/315 (80%), Positives = 285/315 (90%)

Query: 1   MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRT 60
           M+SFP  NF+TVK+LS+QD NYLLDRANEYFQ     N ST RL GLTQINLFLETSTRT
Sbjct: 1   MFSFPFDNFITVKNLSIQDTNYLLDRANEYFQNNCQHNKSTERLYGLTQINLFLETSTRT 60

Query: 61  QTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLM 120
           Q SFE+AGKLLG++VININ  NS++KKGEN+ DTI TLNA +PNIIVIRHP+SG +NSL+
Sbjct: 61  QASFEIAGKLLGINVINININNSSIKKGENLIDTITTLNATQPNIIVIRHPFSGGINSLI 120

Query: 121 HKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLL 180
           HKIKG SIINAGDGTHEHPSQALLD+FAIRHFKGKISNL IAICGDILHSRVARS+I+LL
Sbjct: 121 HKIKGTSIINAGDGTHEHPSQALLDSFAIRHFKGKISNLCIAICGDILHSRVARSNIILL 180

Query: 181 NTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIR 240
           NTMGARIRVIAP TLLP +ISNMGVEVFHDM+KGLK+VDVIMILRMQ ER+P+SL+PS+R
Sbjct: 181 NTMGARIRVIAPTTLLPTNISNMGVEVFHDMEKGLKDVDVIMILRMQLERMPKSLVPSMR 240

Query: 241 EYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAI 300
           EY H+YSLDE K+KYAKKDA+VMHPGPINRN EISS VADG QSIIQ+QV+MGVAVRMAI
Sbjct: 241 EYTHMYSLDETKIKYAKKDAIVMHPGPINRNCEISSEVADGPQSIIQHQVKMGVAVRMAI 300

Query: 301 IKELLENQNKITQKE 315
           IKEL+ +QNKI QKE
Sbjct: 301 IKELIVHQNKIAQKE 315


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396159|ref|YP_001326626.1| aspartate carbamoyltransferase catalytic subunit [Sinorhizobium medicae WSM419] Length = 313 Back     alignment and organism information
>gi|15965057|ref|NP_385410.1| aspartate carbamoyltransferase catalytic subunit [Sinorhizobium meliloti 1021] Length = 313 Back     alignment and organism information
>gi|218674771|ref|ZP_03524440.1| aspartate carbamoyltransferase catalytic subunit [Rhizobium etli GR56] Length = 318 Back     alignment and organism information
>gi|222085617|ref|YP_002544147.1| aspartate carbamoyltransferase [Agrobacterium radiobacter K84] Length = 318 Back     alignment and organism information
>gi|325292670|ref|YP_004278534.1| aspartate carbamoyltransferase [Agrobacterium sp. H13-3] Length = 313 Back     alignment and organism information
>gi|209548902|ref|YP_002280819.1| aspartate carbamoyltransferase catalytic subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 318 Back     alignment and organism information
>gi|190891325|ref|YP_001977867.1| aspartate carbamoyltransferase [Rhizobium etli CIAT 652] Length = 318 Back     alignment and organism information
>gi|241204126|ref|YP_002975222.1| aspartate carbamoyltransferase catalytic subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 318 Back     alignment and organism information
>gi|327190280|gb|EGE57380.1| aspartate carbamoyltransferase catalytic subunit [Rhizobium etli CNPAF512] Length = 318 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase catalyti 1e-120
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase 8e-65
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase catalyti 3e-57
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 1e-40
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Amino ac 7e-35
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase; Pro 7e-34
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase 5e-30
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase; Pro 2e-28
PRK02102331 PRK02102, PRK02102, ornithine carbamoyltransferase; Val 9e-17
KOG1504346 KOG1504, KOG1504, KOG1504, Ornithine carbamoyltransfera 5e-16
PLN02342348 PLN02342, PLN02342, ornithine carbamoyltransferase 1e-14
TIGR03316357 TIGR03316, ygeW, probable carbamoyltransferase YgeW 2e-14
PRK04523335 PRK04523, PRK04523, N-acetylornithine carbamoyltransfer 1e-12
PRK14805302 PRK14805, PRK14805, ornithine carbamoyltransferase; Pro 7e-11
PRK02255338 PRK02255, PRK02255, putrescine carbamoyltransferase; Pr 2e-10
PRK14804311 PRK14804, PRK14804, ornithine carbamoyltransferase; Pro 3e-10
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, catalyti 5e-92
pfam00185155 pfam00185, OTCace, Aspartate/ornithine carbamoyltransfe 2e-41
pfam02729140 pfam02729, OTCace_N, Aspartate/ornithine carbamoyltrans 4e-34
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase; Pro 4e-34
KOG0370 1435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 2e-05
PRK13376 525 PRK13376, pyrB, bifunctional aspartate carbamoyltransfe 6e-20
PRK04284332 PRK04284, PRK04284, ornithine carbamoyltransferase; Pro 2e-16
PRK01713334 PRK01713, PRK01713, ornithine carbamoyltransferase; Pro 5e-10
PRK03515336 PRK03515, PRK03515, ornithine carbamoyltransferase subu 3e-07
PRK07200395 PRK07200, PRK07200, aspartate/ornithine carbamoyltransf 6e-07
PRK12562334 PRK12562, PRK12562, ornithine carbamoyltransferase subu 5e-06
>gnl|CDD|179144 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|161989 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|30427 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|179122 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179366 PRK02102, PRK02102, ornithine carbamoyltransferase; Validated Back     alignment and domain information
>gnl|CDD|36717 KOG1504, KOG1504, KOG1504, Ornithine carbamoyltransferase OTC/ARG3 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177976 PLN02342, PLN02342, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|132359 TIGR03316, ygeW, probable carbamoyltransferase YgeW Back     alignment and domain information
>gnl|CDD|179858 PRK04523, PRK04523, N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184827 PRK14805, PRK14805, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179396 PRK02255, PRK02255, putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173265 PRK14804, PRK14804, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30886 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|143948 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|145728 pfam02729, OTCace_N, Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|184012 PRK13376, pyrB, bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|167776 PRK04284, PRK04284, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|167263 PRK01713, PRK01713, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179587 PRK03515, PRK03515, ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|180878 PRK07200, PRK07200, aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>gnl|CDD|105755 PRK12562, PRK12562, ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 316 aspartate carbamoyltransferase catalytic subunit [Candi
TIGR00658341 orni_carb_tr ornithine carbamoyltransferase; InterPro: 100.0
PRK00856304 pyrB aspartate carbamoyltransferase catalytic subunit; 100.0
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subunit; 100.0
PRK08192338 aspartate carbamoyltransferase; Provisional 100.0
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid transpo 100.0
PRK03515334 ornithine carbamoyltransferase subunit I; Provisional 100.0
PRK12562334 ornithine carbamoyltransferase subunit F; Provisional 100.0
PRK04284332 ornithine carbamoyltransferase; Provisional 100.0
PRK02255341 putrescine carbamoyltransferase; Provisional 100.0
PRK02102331 ornithine carbamoyltransferase; Validated 100.0
PRK01713334 ornithine carbamoyltransferase; Provisional 100.0
PRK00779308 ornithine carbamoyltransferase; Provisional 100.0
TIGR00670336 asp_carb_tr aspartate carbamoyltransferase; InterPro: I 100.0
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members of thi 100.0
PRK07200395 aspartate/ornithine carbamoyltransferase family protein 100.0
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic chain [N 100.0
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 100.0
PRK11891430 aspartate carbamoyltransferase; Provisional 100.0
KOG1504346 consensus 100.0
PRK13376 524 pyrB bifunctional aspartate carbamoyltransferase cataly 100.0
pfam02729140 OTCace_N Aspartate/ornithine carbamoyltransferase, carb 100.0
pfam00185155 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Or 100.0
PRK06436303 glycerate dehydrogenase; Provisional 95.59
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 95.26
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 93.34
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 93.02
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 92.78
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 92.32
PRK00257 379 erythronate-4-phosphate dehydrogenase; Validated 97.02
PRK07574385 formate dehydrogenase; Provisional 96.76
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 96.53
PRK13243333 glyoxylate reductase; Reviewed 96.27
PRK12480330 D-lactate dehydrogenase; Provisional 96.21
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 96.03
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 96.0
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 95.96
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.88
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 95.47
PRK06932314 glycerate dehydrogenase; Provisional 95.24
PRK06487317 glycerate dehydrogenase; Provisional 94.96
PRK08605332 D-lactate dehydrogenase; Validated 94.73
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 95.2
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 95.16
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 92.85
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 94.6
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.03
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 92.1
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.44
PRK05442325 malate dehydrogenase; Provisional 90.17
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase; InterPro: IPR002292 The ornithine carbamoyltransferases are a family of enzymes that catalyse the production of citrulline from carbamoyl-phosphate and ornithine Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase; InterPro: IPR002082 Aspartate carbamoyltransferase (ATCase) catalyses the formation of carbamoyl-aspartate in the pyrimidine biosynthesis pathway, by the association of aspartate and carbamoyl-phosphate Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>KOG1504 consensus Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain Back     alignment and domain information
>pfam00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
1a1s_A314 Ornithine Carbamoyltransferase From Pyrococcus Furi 5e-55
1pvv_A315 Refined Structure Of Pyrococcus Furiosus Ornithine 1e-54
2at2_A300 Molecular Structure Of Bacillus Subtilis Aspartate 3e-48
2i6u_A307 Crystal Structure Of Ornithine Carbamoyltransferase 2e-46
1akm_A333 Ornithine Transcarbamylase From Escherichia Coli Le 6e-44
2otc_A333 Ornithine Transcarbamoylase Complexed With N- (Phos 1e-43
2ef0_A301 Crystal Structure Of Ornithine Carbamoyltransferase 1e-42
1oth_A321 Crystal Structure Of Human Ornithine Transcarbamoyl 2e-42
1ml4_A308 The Pala-Liganded Aspartate Transcarbamoylase Catal 2e-42
1vlv_A325 Crystal Structure Of Ornithine Carbamoyltransferase 7e-42
1fb5_A320 Low Resolution Structure Of Ovine Ornithine Transca 1e-41
3mpu_A310 Crystal Structure Of The C47aA241C DISULFIDE-Linked 3e-41
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 4e-41
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 4e-41
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 5e-41
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 6e-41
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 6e-41
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 6e-41
9atc_A310 Atcase Y165f Mutant Length = 310 8e-41
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 2e-40
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 2e-40
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 4e-40
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 4e-40
3d6n_B291 Crystal Structure Of Aquifex Dihydroorotase Activat 5e-40
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 6e-40
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 7e-40
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 2e-39
3gd5_A323 Crystal Structure Of Ornithine Carbamoyltransferase 2e-39
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 3e-39
1ort_A335 Ornithine Transcarbamoylase From Pseudomonas Aerugi 1e-38
1dxh_A335 Catabolic Ornithine Carbamoyltransferase From Pseud 1e-38
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 6e-38
3m5c_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-36
2g6c_A359 Crystal Structure Of X. Campestris N-Acetylornithin 4e-35
2g6a_A359 Crystal Structure Of X. Campestris N-Acetylornithin 4e-35
2g65_A359 Crystal Structure Of X. Campestris N-Acetylornithin 4e-35
2g68_A359 Crystal Structure Of X. Campestris N-Acetylornithin 4e-35
1zq2_A359 Crystal Structure Of Acetylornithine Transcarbamyla 5e-35
3l06_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 5e-35
2w37_A359 Crystal Structure Of The Hexameric Catabolic Ornith 6e-35
3l05_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 6e-35
3l02_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 6e-35
3kzc_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 6e-35
3l04_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 7e-35
3m5d_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 7e-35
3m4n_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 8e-35
3grf_A328 X-Ray Structure Of Ornithine Transcarbamoylase From 3e-34
2be9_A300 Crystal Structure Of The Ctp-Liganded (T-State) Asp 5e-34
1pg5_A299 Crystal Structure Of The Unligated (T-State) Aspart 5e-34
1js1_X324 Crystal Structure Of A New Transcarbamylase From Th 8e-21
2fg6_X338 N-Succinyl-L-Ornithine Transcarbamylase From B. Fra 9e-21
2g7m_X338 Crystal Structure Of B. Fragilis N-Succinylornithin 1e-20
3q98_A399 Structure Of Ygew Encoded Protein From E. Coli Leng 1e-07
>gi|157829642|pdb|1A1S|A Chain A, Ornithine Carbamoyltransferase From Pyrococcus Furiosus Length = 314 Back     alignment and structure
 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 76/314 (24%), Positives = 132/314 (42%), Gaps = 14/314 (4%)

Query: 3   SFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQT 62
           S    + + ++D + +++  +L+ A   F+           L+G T   +F + STRT+ 
Sbjct: 3   SLAGRDLLCLQDYTAEEIWTILETAK-MFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRV 61

Query: 63  SFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHK 122
           SFEVA   LG H + +N ++  +++GE IADT   L+    + I+ R      V  L   
Sbjct: 62  SFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYV-DAIMARVYDHKDVEDLAKY 120

Query: 123 IKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGD---ILHSRVARSDIML 179
              P  +  G     HP QAL D   I   KG I  + +   GD   + HS +     + 
Sbjct: 121 ATVP--VINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLG 178

Query: 180 LNTMGARIRVIAPITLLPKDISNM------GVEVFHDMQKGLKNVDVIMILRMQQERIPR 233
            + + A      P   + K             E+ HD  K +K+ DVI            
Sbjct: 179 ADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEA 238

Query: 234 SLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMG 293
                 R+    + +++  +K+AK D + MH  P +R  E++  V D   S++  Q E  
Sbjct: 239 -EAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENR 297

Query: 294 VAVRMAIIKELLEN 307
           +  + A++  ++  
Sbjct: 298 LHAQKAVLALVMGG 311


gi|40889330|pdb|1PVV|A Chain A, Refined Structure Of Pyrococcus Furiosus Ornithine Carbamoyltransferase At 1.87 A Length = 315 Back     alignment and structure
>gi|494729|pdb|2AT2|A Chain A, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300 Back     alignment and structure
>gi|151567659|pdb|2I6U|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase Complexed With Carbamoyl Phosphate And L-Norvaline From Mycobacterium Tuberculosis (Rv1656) At 2.2 A Length = 307 Back     alignment and structure
>gi|3212448|pdb|1AKM|A Chain A, Ornithine Transcarbamylase From Escherichia Coli Length = 333 Back     alignment and structure
>gi|3318807|pdb|2OTC|A Chain A, Ornithine Transcarbamoylase Complexed With N- (Phosphonacetyl)-L-Ornithine Length = 333 Back     alignment and structure
gi|146387442|pdb|2EF0|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Thermus Thermophilus Length = 301 Back     alignment and structure
>gi|6137343|pdb|1OTH|A Chain A, Crystal Structure Of Human Ornithine Transcarbamoylase Complexed With N-Phosphonacetyl-L-Ornithine Length = 321 Back     alignment and structure
gi|28948651|pdb|1ML4|A Chain A, The Pala-Liganded Aspartate Transcarbamoylase Catalytic Subunit From Pyrococcus Abyssi Length = 308 Back     alignment and structure
>gi|55670454|pdb|1VLV|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase (Tm1097) From Thermotoga Maritima At 2.25 A Resolution Length = 325 Back     alignment and structure
gi|34810173|pdb|1FB5|A Chain A, Low Resolution Structure Of Ovine Ornithine Transcarbmoylase In The Unliganded State Length = 320 Back     alignment and structure
>gi|301015943|pdb|3MPU|A Chain A, Crystal Structure Of The C47aA241C DISULFIDE-Linked E. Coli Aspartate Transcarbamoylase Holoenzyme Length = 310 Back     alignment and structure
>gi|494498|pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>gi|6980786|pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl- L-Aspartate (Pala) Length = 310 Back     alignment and structure
>gi|14278212|pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>gi|47169156|pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>gi|78101178|pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
gi|8569590|pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>gi|5822587|pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>gi|229685|pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>gi|51247732|pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>gi|67463870|pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
gi|209447313|pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure
gi|221046674|pdb|3D6N|B Chain B, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 291 Back     alignment and structure
>gi|11513487|pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>gi|118137347|pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure
>gi|291191348|pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>gi|226887854|pdb|3GD5|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Gloeobacter Violaceus Length = 323 Back     alignment and structure
>gi|229664|pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>gi|1943014|pdb|1ORT|A Chain A, Ornithine Transcarbamoylase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>gi|13096652|pdb|1DXH|A Chain A, Catabolic Ornithine Carbamoyltransferase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>gi|640095|pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure
>gi|301598567|pdb|3M5C|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302e Mutant Complexed With Palao Length = 359 Back     alignment and structure
>gi|292659728|pdb|3L06|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92v Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|268612125|pdb|2W37|A Chain A, Crystal Structure Of The Hexameric Catabolic Ornithine Transcarbamylase From Lactobacillus Hilgardii Length = 359 Back     alignment and structure
>gi|292659727|pdb|3L05|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92s Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|292659725|pdb|3L02|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92a Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|292659720|pdb|3KZC|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase Length = 359 Back     alignment and structure
>gi|292659726|pdb|3L04|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92p Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|301598568|pdb|3M5D|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302r Mutant Complexed With Palao Length = 359 Back     alignment and structure
>gi|301598550|pdb|3M4N|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302a Mutant Complexed With Palao Length = 359 Back     alignment and structure
>gi|242556558|pdb|3GRF|A Chain A, X-Ray Structure Of Ornithine Transcarbamoylase From Giardia Lamblia Length = 328 Back     alignment and structure
>gi|118137353|pdb|2BE9|A Chain A, Crystal Structure Of The Ctp-Liganded (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 300 Back     alignment and structure
>gi|49258477|pdb|1PG5|A Chain A, Crystal Structure Of The Unligated (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 299 Back     alignment and structure
>gi|22218872|pdb|1JS1|X Chain X, Crystal Structure Of A New Transcarbamylase From The Anaerobic Bacterium Bacteroides Fragilis At 2.0 A Resolution Length = 324 Back     alignment and structure
>gi|109157615|pdb|2FG6|X Chain X, N-Succinyl-L-Ornithine Transcarbamylase From B. Fragilis Complexed With Sulfate And N-Succinyl-L-Norvaline Length = 338 Back     alignment and structure
>gi|134104373|pdb|2G7M|X Chain X, Crystal Structure Of B. Fragilis N-Succinylornithine Transcarbamylase P90e Mutant Complexed With Carbamoyl Phosphate And N-Acetylnorvaline Length = 338 Back     alignment and structure
>gi|332138218|pdb|3Q98|A Chain A, Structure Of Ygew Encoded Protein From E. Coli Length = 399 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, pores 2e-69
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 2.50A 7e-65
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 1.87 1e-61
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, protei 5e-57
3grf_A328 Ornithine carbamoyltransferase; ornithine transcarbamoy 9e-57
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus acido 3e-55
1oth_A321 Protein (ornithine transcarbamoylase); transferase; HET 7e-53
1js1_X324 Transcarbamylase; alpha/beta topology, two domains, tra 1e-50
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crystallo 1e-47
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, structural ge 1e-47
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta two- 1e-47
2rgw_A306 Aspartate carbamoyltransferase; aspartate transcarbamoy 3e-46
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural geno 4e-46
3csu_A310 Protein (aspartate carbamoyltransferase); transferase ( 5e-46
2at2_A300 Aspartate carbamoyltransferase; 3.00A {Bacillus subtili 7e-44
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, structu 2e-43
2w37_A359 Ornithine carbamoyltransferase, catabolic; transcarbamy 3e-42
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhibitor 1e-36
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal- binding, pyrimidine biosynthesis, zinc; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
 Score =  257 bits (658), Expect = 2e-69
 Identities = 110/298 (36%), Positives = 166/298 (55%), Gaps = 10/298 (3%)

Query: 8   NFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVA 67
           + ++  DL+ ++V  +L  A E+ + K             + +  F E STRT+ SFE A
Sbjct: 3   SLISSLDLTREEVEEILKYAKEFKEGKE-------ETIKASAVLFFSEPSTRTRLSFEKA 55

Query: 68  GKLLGVHVININTKNSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPS 127
            + LG+    ++   S+  KGE+  DT+ T   L  + +V R P+       + K     
Sbjct: 56  ARELGIETYLVSGSESSTVKGESFFDTLKTFEGLGFDYVVFRVPFVFFPYKEIVKSLNLR 115

Query: 128 IINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAICGDILHSRVARSDIMLLNTMGARI 187
           ++NAGDGTH+HPSQ L+D F I+   G++ +L +   GDI HSRV RS   LLN  GA+I
Sbjct: 116 LVNAGDGTHQHPSQGLIDFFTIKEHFGEVKDLRVLYVGDIKHSRVFRSGAPLLNMFGAKI 175

Query: 188 RVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRSLIPSIREYKHVYS 247
            V  P TL+P+D+    V+VF D+ KG+   DV++ LR+Q+ER   + IPS   Y   + 
Sbjct: 176 GVCGPKTLIPRDVEVFKVDVFDDVDKGIDWADVVIWLRLQKERQKENYIPSESSYFKQFG 235

Query: 248 LDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELL 305
           L +++    +K  L MHPGP+NRN +I   +    +S+IQ QV+ G+ VR AI K L 
Sbjct: 236 LTKERF---EKVKLYMHPGPVNRNVDIDHELVYTEKSLIQEQVKNGIPVRKAIYKFLW 290


>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Length = 335 Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Length = 324 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus HB8} Length = 301 Back     alignment and structure
>2rgw_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, pyrimidine biosynthesis, thermostability; 2.80A {Methanococcus jannaschii} PDB: 3e2p_A Length = 306 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis; 2.10A {Gloeobacter violaceus pcc 7421} Length = 323 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli K12} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
>2at2_A Aspartate carbamoyltransferase; 3.00A {Bacillus subtilis} SCOP: c.78.1.1 c.78.1.1 Length = 300 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Length = 325 Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Length = 359 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Length = 333 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target316 aspartate carbamoyltransferase catalytic subunit [Candi
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, protei 100.0
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, pores 100.0
3csu_A310 Protein (aspartate carbamoyltransferase); transferase ( 100.0
2at2_A300 Aspartate carbamoyltransferase; 3.00A {Bacillus subtili 100.0
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhibitor 100.0
2rgw_A306 Aspartate carbamoyltransferase; aspartate transcarbamoy 100.0
2w37_A359 Ornithine carbamoyltransferase, catabolic; transcarbamy 100.0
3grf_A328 Ornithine carbamoyltransferase; ornithine transcarbamoy 100.0
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 1.87 100.0
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, structu 100.0
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 2.50A 100.0
1oth_A321 Protein (ornithine transcarbamoylase); transferase; HET 100.0
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural geno 100.0
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crystallo 100.0
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus acido 100.0
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta two- 100.0
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, structural ge 100.0
1js1_X324 Transcarbamylase; alpha/beta topology, two domains, tra 100.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 97.08
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 96.43
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear protein, p 96.38
2rir_A300 Dipicolinate synthase, A chain; structural genomics, AP 96.29
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 96.14
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 96.13
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 95.98
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural genomics 95.95
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, structura 95.89
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 95.88
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 95.82
3kbo_A315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 95.6
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 95.58
3evt_A324 Phosphoglycerate dehydrogenase; structural genomics, PS 95.36
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 95.34
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 95.19
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgcid, S- 95.06
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; structura 95.03
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, dime 94.86
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 94.78
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 94.7
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 94.64
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 94.56
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A 94.5
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structural g 94.2
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 93.88
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 93.85
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor complex, hy 93.49
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, PSI-I 93.39
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 91.96
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 90.16
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 95.66
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural genom 95.46
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, structur 92.68
3p2o_A285 Bifunctional protein fold; structural genomics, center 94.94
3l07_A285 Bifunctional protein fold; structural genomics, IDP0184 94.05
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 94.59
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, national pr 92.54
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain- 90.12
3c24_A286 Putative oxidoreductase; YP_511008.1, structural genomi 93.94
1b0a_A288 Protein (fold bifunctional protein); folate, dehydrogen 92.56
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; HET: 91.97
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=635.63  Aligned_cols=298  Identities=33%  Similarity=0.461  Sum_probs=275.9

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCC-CCC
Q ss_conf             7777741782238999999999999999964420487752128976999960787337899997987613521112-333
Q gi|254780300|r    3 SFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVINI-NTK   81 (316)
Q Consensus         3 ~f~~k~fL~~~dl~~~el~~ll~~A~~~k~~~~~~~~~~~~L~gk~~~~lF~kpStRTR~SFe~A~~~LGg~~i~l-~~~   81 (316)
                      +|.+||||+++||+++|+..||++|.++|+.+.++. ..++|+||+++++|+|||||||+|||+|+.+|||+++++ +++
T Consensus         2 ~~~~r~~L~i~dls~~ei~~ll~~A~~lk~~~~~~~-~~~~l~gk~v~llF~~pStRTR~SFe~A~~~LGg~~i~~~~~~   80 (308)
T 1ml4_A            2 DWKGRDVISIRDFSKEDIETVLATAERLERELKEKG-QLEYAKGKILATLFFEPSTRTRLSFESAMHRLGGAVIGFAEAS   80 (308)
T ss_dssp             CCTTCCBCCGGGCCHHHHHHHHHHHHHHHHHHHHHS-SCCTTTTCEEEEEESSCCSHHHHHHHHHHHHTTCEEEEESCGG
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             899988565001899999999999999998776068-8776799889998348975378999999997599278667853


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCE
Q ss_conf             32101333422479998741367146520321005542001234211112345663122332222222012221000100
Q gi|254780300|r   82 NSAMKKGENIADTIATLNALRPNIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHI  161 (316)
Q Consensus        82 ~s~~~kgEs~~Dta~vls~~~~d~iv~R~~~~~~~~~~a~~~s~ppVINag~~~~~HP~Q~LaDl~Ti~e~~g~l~~l~i  161 (316)
                      .+++++|||++||++|+|+| +|+|++|++.++.+.++++++++| |||||+|..+||||+|+|++||+|++|+++|+||
T Consensus        81 ~~~~~~~Es~~Dta~vls~~-~D~iviR~~~~~~~~~~a~~~~vP-VINAg~~~~~HPtQ~L~Dl~Ti~e~~g~l~glki  158 (308)
T 1ml4_A           81 TSSVKKGESLRDTIKTVEQY-CDVIVIRHPKEGAARLAAEVAEVP-VINAGDGSNQHPTQTLLDLYTIKKEFGRIDGLKI  158 (308)
T ss_dssp             GSGGGGTCCHHHHHHHHTTT-CSEEEEEESSTTHHHHHHHTCSSC-EEEEEETTSCCHHHHHHHHHHHHHHSSCSSSEEE
T ss_pred             CCCCCCCCCHHHHHHHHHCC-CCEEEEEECHHHHHHHHHHCCCCC-EEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             12157875099999875314-855999723000589987558976-7757779876807899868617563388357779


Q ss_pred             EECCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCC-------CCCCCCCCCCCHHHCCCCCCEEEEEEECCHHHHHH
Q ss_conf             10355443301334466420134205532775322211-------21234330058456036862210001133123334
Q gi|254780300|r  162 AICGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKD-------ISNMGVEVFHDMQKGLKNVDVIMILRMQQERIPRS  234 (316)
Q Consensus       162 a~vGD~~~~~v~~S~~~~~~~~g~~v~~~~P~~~~~~~-------~~~~~~~~~~d~~ea~~~aDvv~~~~~~~e~~~~~  234 (316)
                      +|+||+.|+||+||++.+++.+|+++++++|+++.+..       ..+..+.+++|++++++++|+||+++||.|++...
T Consensus       159 ~~vGd~~~~~v~~S~~~~~~~~g~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~~d~~ea~~~aDvv~~~~~~~~~~~~~  238 (308)
T 1ml4_A          159 GLLGDLKYGRTVHSLAEALTFYDVELYLISPELLRMPRHIVEELREKGMKVVETTTLEDVIGKLDVLYVTRIQKERFPDE  238 (308)
T ss_dssp             EEESCTTTCHHHHHHHHHGGGSCEEEEEECCGGGCCCHHHHHHHHHTTCCEEEESCTHHHHTTCSEEEECCCCGGGSSSH
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCEEEEECCHHHCCCHHHHHHHHHCCCCEEECCCHHHHHCCCCEEECCEECCCCCCHH
T ss_conf             86458764412888999998769839997964754878899999971983021289899630575220220023445258


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             4445554202357588999837998599558998768744767976997016868775699999999999778
Q gi|254780300|r  235 LIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAIIKELLEN  307 (316)
Q Consensus       235 ~~~~~~~~~~~~~v~~~~l~~a~~~ai~mHcLP~~Rg~Ev~~~v~d~~~s~v~~Qa~Nrl~~~~AlL~~~l~~  307 (316)
                        .++.+++.+||||.++|++|+++++||||||  ||+||+++|+|+|+|+||+||+||+|+|||||+|+||-
T Consensus       239 --~~~~~~~~~~~v~~~~l~~a~~~~i~mHcLP--Rg~Ei~~~v~d~~~s~v~~QaeNrl~v~~AlL~~llG~  307 (308)
T 1ml4_A          239 --QEYLKVKGSYQVNLKVLEKAKDELRIMHPLP--RVDEIHPEVDNTKHAIYFRQVFNGVPVRMALLALVLGV  307 (308)
T ss_dssp             --HHHHTTTTCCCBCTTGGGGSCTTCEEECCSC--CSSSBCGGGGGSTTBCHHHHHHTHHHHHHHHHHHHHTC
T ss_pred             --HHHHHHHCCCCCCHHHHHHCCCCCEEECCCC--CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             --9999985066579999971699989969999--97612486657874579999972199999999998676



>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal- binding, pyrimidine biosynthesis, zinc; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli K12} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>2at2_A Aspartate carbamoyltransferase; 3.00A {Bacillus subtilis} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>2rgw_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, pyrimidine biosynthesis, thermostability; 2.80A {Methanococcus jannaschii} PDB: 3e2p_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure