254780301

254780301

dihydroorotase

GeneID in NCBI database:8209283Locus tag:CLIBASIA_00930
Protein GI in NCBI database:254780301Protein Accession:YP_003064714.1
Gene range:+(191592, 192887)Protein Length:431aa
Gene description:dihydroorotase
COG prediction:[F] Dihydroorotase and related cyclic amidohydrolases
KEGG prediction:dihydroorotase (EC:3.5.2.3); K01465 dihydroorotase [EC:3.5.2.3]
SEED prediction:Dihydroorotase (EC 3.5.2.3)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES
cccEEEEcEEEEcccccccccccEEEEccEEEEEcccccccccccccEEEEccccEEEEccccccccccccccccccHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEccHHHHcccHHHHHHccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHccccccccccccccEEEEcccccEEEcHHHHHHccccccccccEEEEEEEEEEEccEEEEEccc
ccHHEEEccEEEccccccccccEEEEEccEEEEEcccHHHcccccccEEEEccccEEEcccEEEEEEccccccccccccccHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHcccEEEEEcccccHcccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHccccEEEEEccccEEccHHHccccccccccccccccHHHHHHHHHHHHcccEEEEEcccccccHHHHcccHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHccccccccccccccEEEEcccccEEEcHHHHccccccccccccEEccEEEEEEEccEEEEEccc
mtsfvlnntriidpsrdidEVGAIIVENGIILAAGAdalnakfptsalihdctglvavpgIIDARVtltgspdeysknITTLSKEAVAGGITSIIlmplgmssfldEYTFIKYALEEIRVKSLINVyptacltsnmegkeISEMRLLQEQGIVsfiqspmsihDTQVLLNSMKYAHMLNAIVALDThdhflgsrgviNEGIIANYLglvgipsisetVPLARDLLIAqhtgghyhasvISIPQSIALIKHAKahntkatcgisinnlilneNDVEMYNSLRkvlpplrseTERMSMVEALEkgdidiivsdhtprhmdtkllpfaeasfgsIGLETMLSAALRLFHGQQISLKKLIRALSTrpaqifnlpggtlqtgtaADIALIDLnyqwtvkaddmssihkntvfdkefftGKVVRTYISGkqvytles
mtsfvlnntriidpsrdidEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKntvfdkefftgkvvrtyisgkqvytles
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYT***
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES
MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target431 dihydroorotase [Candidatus Liberibacter asiaticus str.
315122274431 dihydroorotase [Candidatus Liberibacter solanacearum CL 1 0.0
241204125429 dihydroorotase [Rhizobium leguminosarum bv. trifolii WS 1 1e-124
116251504429 dihydroorotase [Rhizobium leguminosarum bv. viciae 3841 1 1e-121
209548901434 dihydroorotase [Rhizobium leguminosarum bv. trifolii WS 1 1e-119
218674770429 dihydroorotase [Rhizobium etli GR56] Length = 429 1 1e-119
86357275429 dihydroorotase [Rhizobium etli CFN 42] Length = 429 1 1e-119
222085616429 dihydroorotase protein [Agrobacterium radiobacter K84] 1 1e-118
190891324429 dihydroorotase [Rhizobium etli CIAT 652] Length = 429 1 1e-118
227821658430 dihydroorotase [Sinorhizobium fredii NGR234] Length = 4 1 1e-115
307317861430 dihydroorotase, multifunctional complex type [Sinorhizo 1 1e-115
>gi|315122274|ref|YP_004062763.1| dihydroorotase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 431 Back     alignment and organism information
 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 379/431 (87%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MTSFVLNN RIIDPSRDIDE+GAIIVENGII+A+G+D LN + PTSA + +C GLVAVPG
Sbjct: 1   MTSFVLNNIRIIDPSRDIDEIGAIIVENGIIIASGSDVLNQELPTSAQVRNCKGLVAVPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +IDARVTL GSP++Y+ NI   SKEA AGGITSIIL P  +S+ +DEYTFIKYA ++I+ 
Sbjct: 61  LIDARVTLEGSPEKYANNIVKTSKEAAAGGITSIILTPFSVSTAMDEYTFIKYAFKKIQE 120

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            SL+NVYPTACLT  MEGK+I+EMRLLQEQG VSF+ +  SI+DTQVLL+SMKYAHMLNA
Sbjct: 121 NSLVNVYPTACLTCKMEGKKINEMRLLQEQGAVSFVHNSRSIYDTQVLLDSMKYAHMLNA 180

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           IV+LDTHD+FLGS+G +NE ++A+ LGL GIP+ISET+PLARDLL+AQHTGGHYHAS IS
Sbjct: 181 IVSLDTHDYFLGSKGTMNESMLADCLGLEGIPAISETIPLARDLLVAQHTGGHYHASAIS 240

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
            PQSI+++ +AK +  KATCGISINNL LNENDV MYNS RKVLPPLRSE ER+ MVE+L
Sbjct: 241 TPQSISILNYAKENKIKATCGISINNLALNENDVGMYNSFRKVLPPLRSEEERVGMVESL 300

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G+IDIIVSDHTP H+DTKLLPFAEA+FGSIGLETMLSAALRLFHGQQISLKKLI+++S
Sbjct: 301 ASGNIDIIVSDHTPHHIDTKLLPFAEATFGSIGLETMLSAALRLFHGQQISLKKLIQSMS 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPAQIFN+PGGTL+ G AADIALIDLN+QW VK+DDM S ++NTVFDKE+FTG+VV TY
Sbjct: 361 TRPAQIFNIPGGTLRAGVAADIALIDLNHQWIVKSDDMLSSYRNTVFDKEYFTGRVVETY 420

Query: 421 ISGKQVYTLES 431
           +SG+ +Y LES
Sbjct: 421 VSGECIYKLES 431


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204125|ref|YP_002975221.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 429 Back     alignment and organism information
>gi|116251504|ref|YP_767342.1| dihydroorotase [Rhizobium leguminosarum bv. viciae 3841] Length = 429 Back     alignment and organism information
>gi|209548901|ref|YP_002280818.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 434 Back     alignment and organism information
>gi|218674770|ref|ZP_03524439.1| dihydroorotase [Rhizobium etli GR56] Length = 429 Back     alignment and organism information
>gi|86357275|ref|YP_469167.1| dihydroorotase [Rhizobium etli CFN 42] Length = 429 Back     alignment and organism information
>gi|222085616|ref|YP_002544146.1| dihydroorotase protein [Agrobacterium radiobacter K84] Length = 429 Back     alignment and organism information
>gi|190891324|ref|YP_001977866.1| dihydroorotase [Rhizobium etli CIAT 652] Length = 429 Back     alignment and organism information
>gi|227821658|ref|YP_002825628.1| dihydroorotase [Sinorhizobium fredii NGR234] Length = 430 Back     alignment and organism information
>gi|307317861|ref|ZP_07597299.1| dihydroorotase, multifunctional complex type [Sinorhizobium meliloti AK83] Length = 430 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target431 dihydroorotase [Candidatus Liberibacter asiaticus str.
PRK09059429 PRK09059, PRK09059, dihydroorotase; Validated 1e-139
COG0044430 COG0044, PyrC, Dihydroorotase and related cyclic amidoh 2e-87
PRK09357423 PRK09357, pyrC, dihydroorotase; Validated 6e-87
PRK07627425 PRK07627, PRK07627, dihydroorotase; Provisional 6e-72
TIGR00857411 TIGR00857, pyrC_multi, dihydroorotase, multifunctional 9e-72
PRK08417386 PRK08417, PRK08417, dihydroorotase; Provisional 1e-51
PRK07369418 PRK07369, PRK07369, dihydroorotase; Provisional 1e-50
cd01315447 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allant 2e-41
TIGR03178443 TIGR03178, allantoinase, allantoinase 1e-37
PRK06189451 PRK06189, PRK06189, allantoinase; Provisional 2e-37
PRK04250398 PRK04250, PRK04250, dihydroorotase; Provisional 2e-27
PRK02382443 PRK02382, PRK02382, dihydroorotase; Provisional 5e-27
cd01314447 cd01314, D-HYD, D-hydantoinases (D-HYD) also called dih 5e-26
PRK08044449 PRK08044, PRK08044, allantoinase; Provisional 1e-25
PLN02795505 PLN02795, PLN02795, allantoinase 3e-21
TIGR02033454 TIGR02033, D-hydantoinase, D-hydantoinase 6e-16
PRK08323459 PRK08323, PRK08323, phenylhydantoinase; Validated 3e-14
KOG2584522 KOG2584, KOG2584, KOG2584, Dihydroorotase and related e 3e-11
PRK13404477 PRK13404, PRK13404, dihydropyrimidinase; Provisional 7e-11
PLN02942486 PLN02942, PLN02942, dihydropyrimidinase 2e-08
COG1228406 COG1228, HutI, Imidazolonepropionase and related amidoh 3e-06
cd01318361 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subgroup 9e-40
cd01302337 cd01302, Cyclic_amidohydrolases, Cyclic amidohydrolases 7e-37
cd01316344 cd01316, CAD_DHOase, The eukaryotic CAD protein is a tr 7e-24
cd01317374 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup 2e-90
PRK07575438 PRK07575, PRK07575, dihydroorotase; Provisional 2e-17
PRK01211409 PRK01211, PRK01211, dihydroorotase; Provisional 1e-11
PRK09236444 PRK09236, PRK09236, dihydroorotase; Reviewed 3e-17
PRK09060444 PRK09060, PRK09060, dihydroorotase; Validated 8e-16
PRK00369392 PRK00369, pyrC, dihydroorotase; Provisional 2e-16
PRK12394379 PRK12394, PRK12394, putative metallo-dependent hydrolas 2e-07
PRK07575438 PRK07575, PRK07575, dihydroorotase; Provisional 5e-07
PRK09236444 PRK09236, PRK09236, dihydroorotase; Reviewed 5e-06
PRK09060444 PRK09060, PRK09060, dihydroorotase; Validated 1e-05
cd01296371 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazo 0.004
PRK09061509 PRK09061, PRK09061, D-glutamate deacylase; Validated 3e-06
PRK09228433 PRK09228, PRK09228, guanine deaminase; Provisional 1e-05
PRK09356406 PRK09356, PRK09356, imidazolonepropionase; Validated 8e-05
PRK15446383 PRK15446, PRK15446, phosphonate metabolism protein PhnM 2e-04
TIGR02967401 TIGR02967, guan_deamin, guanine deaminase 0.002
cd01298411 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enzymes 0.003
PRK09237380 PRK09237, PRK09237, dihydroorotase; Provisional 0.004
COG3964386 COG3964, COG3964, Predicted amidohydrolase [General fun 5e-06
PRK15446383 PRK15446, PRK15446, phosphonate metabolism protein PhnM 0.003
cd01306325 cd01306, PhnM, PhnM is believed to be a subunit of the 0.004
>gnl|CDD|181631 PRK09059, PRK09059, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|30393 COG0044, PyrC, Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181796 PRK09357, pyrC, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|181059 PRK07627, PRK07627, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|162070 TIGR00857, pyrC_multi, dihydroorotase, multifunctional complex type Back     alignment and domain information
>gnl|CDD|181418 PRK08417, PRK08417, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|180948 PRK07369, PRK07369, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|30058 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>gnl|CDD|163175 TIGR03178, allantoinase, allantoinase Back     alignment and domain information
>gnl|CDD|180455 PRK06189, PRK06189, allantoinase; Provisional Back     alignment and domain information
>gnl|CDD|179801 PRK04250, PRK04250, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|179417 PRK02382, PRK02382, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|30057 cd01314, D-HYD, D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>gnl|CDD|169193 PRK08044, PRK08044, allantoinase; Provisional Back     alignment and domain information
>gnl|CDD|178392 PLN02795, PLN02795, allantoinase Back     alignment and domain information
>gnl|CDD|162669 TIGR02033, D-hydantoinase, D-hydantoinase Back     alignment and domain information
>gnl|CDD|181388 PRK08323, PRK08323, phenylhydantoinase; Validated Back     alignment and domain information
>gnl|CDD|37795 KOG2584, KOG2584, KOG2584, Dihydroorotase and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184033 PRK13404, PRK13404, dihydropyrimidinase; Provisional Back     alignment and domain information
>gnl|CDD|178530 PLN02942, PLN02942, dihydropyrimidinase Back     alignment and domain information
>gnl|CDD|31421 COG1228, HutI, Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|30061 cd01318, DHOase_IIb, Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|73256 cd01302, Cyclic_amidohydrolases, Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>gnl|CDD|30059 cd01316, CAD_DHOase, The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|30060 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>gnl|CDD|181042 PRK07575, PRK07575, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|179247 PRK01211, PRK01211, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|181716 PRK09236, PRK09236, dihydroorotase; Reviewed Back     alignment and domain information
>gnl|CDD|181632 PRK09060, PRK09060, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|178990 PRK00369, pyrC, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|183497 PRK12394, PRK12394, putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|181042 PRK07575, PRK07575, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|181716 PRK09236, PRK09236, dihydroorotase; Reviewed Back     alignment and domain information
>gnl|CDD|181632 PRK09060, PRK09060, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|30039 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>gnl|CDD|181633 PRK09061, PRK09061, D-glutamate deacylase; Validated Back     alignment and domain information
>gnl|CDD|181711 PRK09228, PRK09228, guanine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|181795 PRK09356, PRK09356, imidazolonepropionase; Validated Back     alignment and domain information
>gnl|CDD|185343 PRK15446, PRK15446, phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>gnl|CDD|132012 TIGR02967, guan_deamin, guanine deaminase Back     alignment and domain information
>gnl|CDD|30041 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>gnl|CDD|181717 PRK09237, PRK09237, dihydroorotase; Provisional Back     alignment and domain information
>gnl|CDD|33745 COG3964, COG3964, Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|185343 PRK15446, PRK15446, phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>gnl|CDD|30049 cd01306, PhnM, PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 431 dihydroorotase [Candidatus Liberibacter asiaticus str.
PRK09059429 dihydroorotase; Validated 100.0
PRK07627425 dihydroorotase; Provisional 100.0
PRK09357425 pyrC dihydroorotase; Validated 100.0
PRK07575439 dihydroorotase; Provisional 100.0
PRK09236444 dihydroorotase; Reviewed 100.0
PRK02382440 dihydroorotase; Provisional 100.0
PRK07369419 dihydroorotase; Provisional 100.0
PRK08044449 allantoinase; Provisional 100.0
PRK06189433 allantoinase; Provisional 100.0
PRK13404476 dihydropyrimidinase; Provisional 100.0
PRK09060444 dihydroorotase; Validated 100.0
TIGR03178442 allantoinase allantoinase. This enzyme carries out the 100.0
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (AL 100.0
PRK08323463 dihydropyrimidinase; Validated 100.0
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimi 100.0
COG0044430 PyrC Dihydroorotase and related cyclic amidohydrolases 100.0
PRK04250408 dihydroorotase; Provisional 100.0
TIGR00857459 pyrC_multi dihydroorotase, multifunctional complex type 100.0
TIGR02033466 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778 100.0
PRK01211413 dihydroorotase; Provisional 100.0
PRK08417387 dihydroorotase; Provisional 100.0
PRK00369393 pyrC dihydroorotase; Provisional 100.0
KOG2584522 consensus 100.0
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid ami 100.0
PRK10657384 isoaspartyl dipeptidase; Provisional 100.0
PRK06038432 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK08204451 hypothetical protein; Provisional 100.0
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK09237384 dihydroorotase; Provisional 100.0
PRK09061496 D-glutamate deacylase; Validated 100.0
PRK08203456 hydroxydechloroatrazine ethylaminohydrolase; Reviewed 100.0
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, 100.0
PRK06687422 chlorohydrolase; Validated 100.0
PRK12393459 amidohydrolase; Provisional 100.0
PRK08393419 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK09045444 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK09356401 imidazolonepropionase; Validated 100.0
PRK12394387 putative metallo-dependent hydrolase; Provisional 100.0
PRK09228429 guanine deaminase; Provisional 99.98
COG1228406 HutI Imidazolonepropionase and related amidohydrolases 99.98
PRK08418407 chlorohydrolase; Provisional 99.98
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 99.97
TIGR03179427 gua_deam guanine deaminase. This enzyme converts guanin 99.97
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. Memb 99.97
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. Membe 99.97
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgr 99.97
PRK10027 588 cryptic adenine deaminase; Provisional 99.97
cd01293398 Bact_CD Bacterial cytosine deaminase and related metal- 99.97
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deaminase is 99.96
PRK05985398 cytosine deaminase; Provisional 99.96
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and metabo 99.96
COG1574535 Predicted metal-dependent hydrolase with the TIM-barrel 99.95
TIGR03121 556 one_C_dehyd_A formylmethanofuran dehydrogenase subunit 99.93
cd01304541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit 99.92
COG0402421 SsnA Cytosine deaminase and related metal-dependent hyd 99.92
PRK13308569 ureC urease subunit alpha; Reviewed 99.89
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolases. Yt 99.89
COG3653 579 N-acyl-D-aspartate/D-glutamate deacylase [Secondary met 99.89
PRK07572425 cytosine deaminase; Validated 99.89
TIGR02967426 guan_deamin guanine deaminase; InterPro: IPR014311 This 99.89
COG3964386 Predicted amidohydrolase [General function prediction o 99.89
PRK07583437 cytosine deaminase; Validated 99.88
PRK13207568 ureC urease subunit alpha; Reviewed 99.88
PRK13985568 UreB urease subunit beta; Provisional 99.88
cd00375567 Urease_alpha Urease alpha-subunit; Urease is a nickel-d 99.88
PRK13309572 ureC urease subunit alpha; Reviewed 99.88
PRK13206573 ureC urease subunit alpha; Reviewed 99.88
PRK09230426 cytosine deaminase; Provisional 99.87
COG1229 575 FwdA Formylmethanofuran dehydrogenase subunit A [Energy 99.82
COG0804568 UreC Urea amidohydrolase (urease) alpha subunit [Amino 99.77
PRK06846410 deaminase; Validated 99.76
TIGR01178 575 ade adenine deaminase; InterPro: IPR006679 Adenine deam 99.1
TIGR00221408 nagA N-acetylglucosamine-6-phosphate deacetylase; Inter 99.09
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOas 100.0
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOas 100.0
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, includin 100.0
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunctiona 99.97
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydroly 100.0
PRK11170381 nagA N-acetylglucosamine-6-phosphate deacetylase; Provi 100.0
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbo 99.96
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the a 100.0
PRK06151480 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK06380418 metal-dependent hydrolase; Provisional 100.0
PRK07213378 chlorohydrolase; Provisional 99.97
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgr 99.97
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-pro 99.95
PRK09229457 N-formimino-L-glutamate deiminase; Validated 99.94
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgr 99.94
TIGR02318391 phosphono_phnM phosphonate metabolism protein PhnM; Int 99.93
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgr 99.92
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates adeni 99.87
COG3454377 Metal-dependent hydrolase involved in phosphonate metab 99.86
KOG3968439 consensus 99.86
KOG3892407 consensus 99.71
cd01306325 PhnM PhnM is believed to be a subunit of the membrane a 99.54
) would yield glutamate.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02022">TIGR02022466 hutF formiminoglutamate deiminase; InterPro: IPR010252 99.38
TIGR01975391 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR0102 99.9
TIGR01792 605 urease_alph urease, alpha subunit; InterPro: IPR005848 99.89
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgr 99.88
pfam01979307 Amidohydro_1 Amidohydrolase family. This family of enzy 99.81
pfam07969392 Amidohydro_3 Amidohydrolase family. 99.43
TIGR01224409 hutI imidazolonepropionase; InterPro: IPR005920 Imidazo 99.03
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolases. Th 97.8
PRK06886328 hypothetical protein; Validated 96.9
cd01292275 metallo-dependent_hydrolases Superfamily of metallo-dep 96.58
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the reversible 99.37
pfam00449121 Urease_alpha Urease alpha-subunit, N-terminal domain. T 96.59
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>PRK08323 dihydropyrimidinase; Validated Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type; InterPro: IPR004722 Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue Back     alignment and domain information
>TIGR02033 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778 This entry represents the D-hydantoinase (dihydropyrimidinase) which primarily converts 5,6-dihydrouracil to 3-ureidopropanoate but also acts on dihydrothymine and hydantoin Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>KOG2584 consensus Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>TIGR03179 gua_deam guanine deaminase Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase; InterPro: IPR014311 This entry describes guanine deaminase, which hydrolyzes guanine to xanthine and ammonia Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK07583 cytosine deaminase; Validated Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13985 UreB urease subunit beta; Provisional Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion] Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06846 deaminase; Validated Back     alignment and domain information
>TIGR01178 ade adenine deaminase; InterPro: IPR006679 Adenine deaminase (3 Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase; InterPro: IPR003764 Three enzymes are required for N-acetylglucosamine (NAG) utilization in Escherichia coli: enzyme IInag (gene nagE), N-acetylglucosamine-6-phosphate deacetylase (gene nagA), and glucosamine-6-phosphate isomerase (gene nagB) Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM; InterPro: IPR012696 This family consists of proteins from in the PhnM family Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3968 consensus Back     alignment and domain information
>KOG3892 consensus Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase; InterPro: IPR010252 In some species, histidine utilisation goes via urocanate to glutamate in four step, the last being removal of formamide Back     alignment and domain information
>TIGR01975 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR010229 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit; InterPro: IPR005848 Urease (urea amidohydrolase, 3 Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>pfam01979 Amidohydro_1 Amidohydrolase family Back     alignment and domain information
>pfam07969 Amidohydro_3 Amidohydrolase family Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase; InterPro: IPR005920 Imidazolonepropionase (3 Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>pfam00449 Urease_alpha Urease alpha-subunit, N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target431 dihydroorotase [Candidatus Liberibacter asiaticus str.
3d6n_A422 Crystal Structure Of Aquifex Dihydroorotase Activat 4e-70
1xrf_A467 The Crystal Structure Of A Novel, Latent Dihydrooro 8e-70
3mpg_A428 Dihydroorotase From Bacillus Anthracis Length = 428 5e-69
3gri_A424 The Crystal Structure Of A Dihydroorotase From Stap 1e-60
3e74_A473 Crystal Structure Of E. Coli Allantoinase With Iron 3e-59
1k1d_A460 Crystal Structure Of D-Hydantoinase Length = 460 2e-51
3dc8_A490 Crystal Structure Of Dihydropyrimidinase From Sinor 1e-50
3hm7_A448 Crystal Structure Of Allantoinase From Bacillus Hal 3e-49
2vr2_A541 Human Dihydropyrimidinase Length = 541 1e-48
2gwn_A452 The Structure Of Putative Dihydroorotase From Porph 3e-48
2z00_A426 Crystal Structure Of Dihydroorotase From Thermus Th 4e-48
1yny_A461 Molecular Structure Of D-Hydantoinase From A Bacill 9e-48
1gkp_A458 D-Hydantoinase (Dihydropyrimidinase) From Thermus S 2e-47
2ftw_A521 Crystal Structure Of Dihydropyrimidinase From Dicty 6e-46
1kcx_A518 X-Ray Structure Of Nysgrc Target T-45 Length = 518 1e-44
1nfg_A457 Structure Of D-Hydantoinase Length = 457 3e-44
1gkr_A458 L-Hydantoinase (Dihydropyrimidinase) From Arthrobac 9e-44
2gse_A501 Crystal Structure Of Human Dihydropyrimidinease-Lik 2e-43
2fty_A559 Crystal Structure Of Dihydropyrimidinase From Sacch 2e-34
1rjp_A496 Crystal Structure Of D-Aminoacylase In Complex With 3e-24
1m7j_A484 Crystal Structure Of D-Aminoacylase Defines A Novel 3e-24
1rjq_A496 The Crystal Structure Of The D-Aminoacylase Mutant 4e-24
1v4y_A496 The Functional Role Of The Binuclear Metal Center I 6e-24
3h4u_B479 Crystal Structure Of An Amidohydrolase Gi:44264246 3e-23
3gip_A480 Crystal Structure Of N-Acyl-D-Glutamate Deacylase F 6e-23
3lsb_A456 Crystal Structure Of The Mutant E241q Of Atrazine C 5e-22
3ls9_A456 Crystal Structure Of Atrazine Chlorohydrolase Trzn 6e-22
3la4_A 840 Crystal Structure Of The First Plant Urease From Ja 1e-21
1p1m_A406 Structure Of Thermotoga Maritima Amidohydrolase Tm0 2e-19
2vhl_A396 The Three-Dimensional Structure Of The N-Acetylgluc 2e-17
3feq_A423 Crystal Structure Of Uncharacterized Protein Eah899 1e-16
3lwy_B423 Crystal Structure Of Prolidase Eah89906 Complexed W 2e-16
2bb0_A421 Structure Of Imidazolonepropionase From Bacillus Su 8e-16
3lnp_A468 Crystal Structure Of Amidohydrolase Family Protein 8e-15
1j6p_A418 Crystal Structure Of Metal-Dependent Hydrolase Of C 4e-14
1ubp_C570 Crystal Structure Of Urease From Bacillus Pasteurii 2e-22
1ie7_C570 Phosphate Inhibited Bacillus Pasteurii Urease Cryst 3e-22
1a5o_C566 K217c Variant Of Klebsiella Aerogenes Urease, Chemi 1e-20
1fwf_C567 Klebsiella Aerogenes Urease, C319d Variant Length = 2e-20
1fwa_C567 Klebsiella Aerogenes Urease, C319a Variant At Ph 7. 2e-20
1ef2_A566 Crystal Structure Of Manganese-Substituted Klebsiel 2e-20
1a5k_C566 K217e Variant Of Klebsiella Aerogenes Urease Length 2e-20
2kau_C567 The Crystal Structure Of Urease From Klebsiella Aer 3e-20
1fwh_C567 Klebsiella Aerogenes Urease, C319y Variant Length = 3e-20
1a5m_C566 K217a Variant Of Klebsiella Aerogenes Urease Length 3e-20
1fwj_C567 Klebsiella Aerogenes Urease, Native Length = 567 3e-20
1eju_C567 Crystal Structure Of The H320n Variant Of Klebsiell 3e-20
1fwg_C567 Klebsiella Aerogenes Urease, C319s Variant Length = 3e-20
1ejt_C567 Crystal Structure Of The H219q Variant Of Klebsiell 3e-20
1ejr_C567 Crystal Structure Of The D221a Variant Of Klebsiell 3e-20
1ejv_C567 Crystal Structure Of The H320q Variant Of Klebsiell 3e-20
1ejs_C567 Crystal Structure Of The H219n Variant Of Klebsiell 3e-20
1krc_C567 Crystal Structure Of Klebsiella Aerogenes Urease, I 4e-20
1krb_C567 Crystal Structure Of Klebsiella Aerogenes Urease, I 4e-20
2qt3_A403 Crystal Structure Of N-Isopropylammelide Isopropyla 8e-19
1fwi_C567 Klebsiella Aerogenes Urease, H134a Variant Length = 3e-18
2r8c_H426 Crystal Structure Of Uncharacterized Protein Eaj561 1e-17
3mkv_A426 Crystal Structure Of Amidohydrolase Eaj56179 Length 1e-17
3be7_A408 Crystal Structure Of Zn-Dependent Arginine Carboxyp 3e-17
3dug_A408 Crystal Structure Of Zn-Dependent Arginine Carboxyp 3e-17
1e9y_B569 Crystal Structure Of Helicobacter Pylori Urease In 1e-15
1e9z_B569 Crystal Structure Of Helicobacter Pylori Urease Len 1e-15
3ooq_A396 Crystal Structure Of Amidohydrolase From Thermotoga 3e-14
3ooq_A396 Crystal Structure Of Amidohydrolase From Thermotoga 7e-10
gi|221046673|pdb|3D6N|A Chain A, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 422 Back     alignment and structure
 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 145/428 (33%), Positives = 225/428 (52%), Gaps = 7/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   ++ N  +IDPS++++    I+VENG I     + L  +    A I D  GL+  PG
Sbjct: 1   MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPE----AEIIDAKGLIVCPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V L      Y ++I + S+ AVAGG T+I+ MP       +  T + Y L++ + 
Sbjct: 57  FIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNT-TVVNYILQKSKS 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V PT  +T   +GKEI++   L+E G V+F      + D+ V+  +++ A  L  
Sbjct: 116 VGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGV 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +  D  +    + GVINEG ++  LGL      +E + +ARD ++AQ TGGH H   +S
Sbjct: 176 PIM-DHCEDDKLAYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+  K    K TC ++ N+L+  E +V    +  +V PPLR + +R++++E +
Sbjct: 235 TKLSLEIIEFFKEKGVKITCEVNPNHLLFTEREVLNSGANARVNPPLRKKEDRLALIEGV 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           ++G ID   +DH P     K L    A  G IGL+T L +AL L+    ISLKKLI   +
Sbjct: 295 KRGIIDCFATDHAPHQTFEKEL-VEFAMPGIIGLQTALPSALELYRKGIISLKKLIEMFT 353

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  +  GTL+ G+ ADI + D N +W +  +   S  +NT    +   GKV+ T 
Sbjct: 354 INPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTI 413

Query: 421 ISGKQVYT 428
             GK VY 
Sbjct: 414 KDGKMVYK 421


>gi|73536332|pdb|1XRF|A Chain A, The Crystal Structure Of A Novel, Latent Dihydroorotase From Aquifex Aeolicus At 1.7 A Resolution Length = 467 Back     alignment and structure
gi|311772131|pdb|3MPG|A Chain A, Dihydroorotase From Bacillus Anthracis Length = 428 Back     alignment and structure
>gi|237823988|pdb|3GRI|A Chain A, The Crystal Structure Of A Dihydroorotase From Staphylococcus Aureus Length = 424 Back     alignment and structure
>gi|224036332|pdb|3E74|A Chain A, Crystal Structure Of E. Coli Allantoinase With Iron Ions At The Metal Center Length = 473 Back     alignment and structure
>gi|23200220|pdb|1K1D|A Chain A, Crystal Structure Of D-Hydantoinase Length = 460 Back     alignment and structure
>gi|227343718|pdb|3DC8|A Chain A, Crystal Structure Of Dihydropyrimidinase From Sinorhizobium Meliloti Length = 490 Back     alignment and structure
>gi|239782181|pdb|3HM7|A Chain A, Crystal Structure Of Allantoinase From Bacillus Halodurans C-125 Length = 448 Back     alignment and structure
>gi|171848936|pdb|2VR2|A Chain A, Human Dihydropyrimidinase Length = 541 Back     alignment and structure
>gi|109158122|pdb|2GWN|A Chain A, The Structure Of Putative Dihydroorotase From Porphyromonas Gingivalis Length = 452 Back     alignment and structure
>gi|160286286|pdb|2Z00|A Chain A, Crystal Structure Of Dihydroorotase From Thermus Thermophilus Length = 426 Back     alignment and structure
>gi|61680756|pdb|1YNY|A Chain A, Molecular Structure Of D-Hydantoinase From A Bacillus Sp. Ar9: Evidence For Mercury Inhibition Length = 461 Back     alignment and structure
>gi|21730171|pdb|1GKP|A Chain A, D-Hydantoinase (Dihydropyrimidinase) From Thermus Sp. In Space Group C2221 Length = 458 Back     alignment and structure
>gi|93279740|pdb|2FTW|A Chain A, Crystal Structure Of Dihydropyrimidinase From Dictyostelium Discoideum Length = 521 Back     alignment and structure
>gi|34810736|pdb|1KCX|A Chain A, X-Ray Structure Of Nysgrc Target T-45 Length = 518 Back     alignment and structure
>gi|34811413|pdb|1NFG|A Chain A, Structure Of D-Hydantoinase Length = 457 Back     alignment and structure
>gi|22218649|pdb|1GKR|A Chain A, L-Hydantoinase (Dihydropyrimidinase) From Arthrobacter Aurescens Length = 458 Back     alignment and structure
>gi|109158020|pdb|2GSE|A Chain A, Crystal Structure Of Human Dihydropyrimidinease-Like 2 Length = 501 Back     alignment and structure
>gi|93279741|pdb|2FTY|A Chain A, Crystal Structure Of Dihydropyrimidinase From Saccharomyces Kluyveri Length = 559 Back     alignment and structure
>gi|48425342|pdb|1RJP|A Chain A, Crystal Structure Of D-Aminoacylase In Complex With 100mm Cucl2 Length = 496 Back     alignment and structure
>gi|28948588|pdb|1M7J|A Chain A, Crystal Structure Of D-Aminoacylase Defines A Novel Subset Of Amidohydrolases Length = 484 Back     alignment and structure
>gi|48425343|pdb|1RJQ|A Chain A, The Crystal Structure Of The D-Aminoacylase Mutant D366a Length = 496 Back     alignment and structure
>gi|48425875|pdb|1V4Y|A Chain A, The Functional Role Of The Binuclear Metal Center In D- Aminoacylase. One-Metal Activation And Second-Metal Attenuation Length = 496 Back     alignment and structure
gi|257097240|pdb|3GIP|A Chain A, Crystal Structure Of N-Acyl-D-Glutamate Deacylase From Bordetella Bronchiseptica Complexed With Zinc, Acetate And Formate Ions. Length = 480 Back     alignment and structure
>gi|301015839|pdb|3LSB|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1 Complexed With Zinc And Ametrin Length = 456 Back     alignment and structure
gi|301015837|pdb|3LS9|A Chain A, Crystal Structure Of Atrazine Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1 Complexed With Zinc Length = 456 Back     alignment and structure
>gi|301598520|pdb|3LA4|A Chain A, Crystal Structure Of The First Plant Urease From Jack Bean (Canavalia Ensiformis) Length = 840 Back     alignment and structure
gi|30750126|pdb|1P1M|A Chain A, Structure Of Thermotoga Maritima Amidohydrolase Tm0936 Bound To Ni And Methionine Length = 406 Back     alignment and structure
gi|161761131|pdb|2VHL|A Chain A, The Three-Dimensional Structure Of The N-Acetylglucosamine- 6-Phosphate Deacetylase From Bacillus Subtilis Length = 396 Back     alignment and structure
>gi|218681969|pdb|3FEQ|A Chain A, Crystal Structure Of Uncharacterized Protein Eah89906 Length = 423 Back     alignment and structure
gi|116666796|pdb|2BB0|A Chain A, Structure Of Imidazolonepropionase From Bacillus Subtilis Length = 421 Back     alignment and structure