254780326

254780326

bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein

GeneID in NCBI database:8209311Locus tag:CLIBASIA_01055
Protein GI in NCBI database:254780326Protein Accession:YP_003064739.1
Gene range:-(218787, 220037)Protein Length:416aa
Gene description:bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
COG prediction:[E] N-acetylglutamate synthase (N-acetylornithine aminotransferase)
KEGG prediction:argJ; bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein (EC:2.3.1.35); K00620 glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
SEED prediction:Glutamate N-acetyltransferase (EC 2.3.1.35) / N-acetylglutamate synthase (EC 2.3.1.1)
Pathway involved in KEGG:Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Arginine Biosynthesis extended;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
cccccccEEcccccccccccccccEEEEEEEEEEEcccccEEEEEEEccccEEEEEEcccccccccHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccHHHEEEEEcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEEEEcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHccccHHHHHccccccccccEEEEEcccccccccccEEEEEEccEEEEccccccccccHHHHHHHHccccEEEEEEEccccccEEEEEccccHHHHHHcccccc
ccccHcccccccccccccccccccEEEHEHHccccccccccEEEEEEccccEEEEEEEccccccccEEEEHHHHHcccEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccHHHEEEEccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccEEEEEEEEccEEEEEEEEEcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccccccccEEEEEccEEEEccccccccccHHHHHHHHccccEEEEEEEccccccEEEEEccccHHEEEEcccccc
mlpisclpfmlqshvspvllpikGVRLSAAALGikyvgrddvflmvfdnpasvagvftrsscpsapvdfckgnlsHGIARALIVNSGianaftgkrgRDTVRFIAKAVSElipckeeeVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLakgagmiapdmATTLAFVVTDINISPAVLQNILSegaeysfnsitvdgdtstsdTLLLFATGtvlgnfapitdvsdkrlslFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGksgvlvdrdrlsvwfgdvrianngepeinfsQESVRSIVKKkcvpitvdlqigngihtvwtcdfskeyIHFNSNVQS
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGianaftgkrgrDTVRFIAKAvselipckeEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKvavrtvdidgirVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDvrianngepeinfsqesVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
***************SPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQ*
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
*********MLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSN*Q*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS
MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
315122249415 bifunctional ornithine acetyltransferase/N-acetylglutam 1 0.0
222087316413 glutamate N-acetyltransferase/amino-acid N-acetyltransf 1 1e-136
241206515413 bifunctional ornithine acetyltransferase/N-acetylglutam 1 1e-134
116254032413 bifunctional ornithine acetyltransferase/N-acetylglutam 1 1e-134
222149928413 bifunctional ornithine acetyltransferase/N-acetylglutam 1 1e-134
209551114413 bifunctional ornithine acetyltransferase/N-acetylglutam 1 1e-133
327193396413 glutamate N-acetyltransferase/amino-acid N-acetyltransf 1 1e-132
190893604413 glutamate N-acetyltransferase/amino-acid N-acetyltransf 1 1e-131
150397714413 bifunctional ornithine acetyltransferase/N-acetylglutam 1 1e-130
332716316413 amino-acid N-acetyltransferase / glutamate N-acetyltran 1 1e-130
>gi|315122249|ref|YP_004062738.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 415 Back     alignment and organism information
 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/415 (76%), Positives = 361/415 (86%)

Query: 2   LPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSS 61
           +PIS    M +S V+PV LPIKGVRLS A+LGIKYVGRDDVFLM+FD PASVAGVFTRS 
Sbjct: 1   MPISSFSLMSRSRVTPVPLPIKGVRLSTASLGIKYVGRDDVFLMLFDKPASVAGVFTRSR 60

Query: 62  CPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYV 121
           CPSAPVDFC+ NL HGIARAL+VNSG ANAFTGKRGRD V FIA+++S+LI C+E+EVYV
Sbjct: 61  CPSAPVDFCRTNLPHGIARALVVNSGNANAFTGKRGRDAVHFIAQSLSDLISCQEDEVYV 120

Query: 122 ASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVT 181
           ASTGIIGEFLD+  FDGV  K+L +ATDDAWLDSAKAMMTTD YAK AVRTV+IDG++VT
Sbjct: 121 ASTGIIGEFLDIGKFDGVFDKLLHNATDDAWLDSAKAMMTTDSYAKTAVRTVNIDGVKVT 180

Query: 182 INGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTL 241
           ING+AKGAGMIAPDMATTLAFVVTDI+IS  VLQ +LSEG E+SFNSITVD DTSTSDTL
Sbjct: 181 INGMAKGAGMIAPDMATTLAFVVTDIDISSPVLQILLSEGVEHSFNSITVDSDTSTSDTL 240

Query: 242 LLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAA 301
           +LF+TGTV  N  PIT + D+RLS FRP LFD+LKDLALQVVCDGEGASK+LEVTVKGA 
Sbjct: 241 MLFSTGTVSENVPPITSIDDQRLSTFRPVLFDILKDLALQVVCDGEGASKILEVTVKGAE 300

Query: 302 DCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKSGVLVDRDRLSVWFGDVRIAN 361
           +  SAK+VA SIANSPLVKTAFAS S GWWGRIVMA+GKSG  VDRD +SVWF ++RIA 
Sbjct: 301 NATSAKQVAFSIANSPLVKTAFASGSIGWWGRIVMAIGKSGAFVDRDSISVWFRNIRIAT 360

Query: 362 NGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS 416
           NGEPEINFSQE V SI+K++C+PI VDL IG+G+HTVWTCDFS EY+ FNSN QS
Sbjct: 361 NGEPEINFSQEDVHSIMKEECIPIVVDLGIGDGVHTVWTCDFSGEYVQFNSNCQS 415


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087316|ref|YP_002545853.1| glutamate N-acetyltransferase/amino-acid N-acetyltransferase protein [Agrobacterium radiobacter K84] Length = 413 Back     alignment and organism information
>gi|241206515|ref|YP_002977611.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 413 Back     alignment and organism information
>gi|116254032|ref|YP_769870.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Rhizobium leguminosarum bv. viciae 3841] Length = 413 Back     alignment and organism information
>gi|222149928|ref|YP_002550885.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Agrobacterium vitis S4] Length = 413 Back     alignment and organism information
>gi|209551114|ref|YP_002283031.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 413 Back     alignment and organism information
>gi|327193396|gb|EGE60296.1| glutamate N-acetyltransferase/amino-acid N-acetyltransferase protein [Rhizobium etli CNPAF512] Length = 413 Back     alignment and organism information
>gi|190893604|ref|YP_001980146.1| glutamate N-acetyltransferase/amino-acid N-acetyltransferase [Rhizobium etli CIAT 652] Length = 413 Back     alignment and organism information
>gi|150397714|ref|YP_001328181.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Sinorhizobium medicae WSM419] Length = 413 Back     alignment and organism information
>gi|332716316|ref|YP_004443782.1| amino-acid N-acetyltransferase / glutamate N-acetyltransferase [Agrobacterium sp. H13-3] Length = 413 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
PRK05388395 PRK05388, argJ, bifunctional ornithine acetyltransferas 1e-144
cd02152390 cd02152, OAT, Ornithine acetyltransferase (OAT) family; 1e-124
COG1364404 COG1364, ArgJ, N-acetylglutamate synthase (N-acetylorni 1e-120
TIGR00120404 TIGR00120, ArgJ, glutamate N-acetyltransferase/amino-ac 2e-81
KOG2786431 KOG2786, KOG2786, KOG2786, Putative glutamate/ornithine 1e-62
pfam01960387 pfam01960, ArgJ, ArgJ family 1e-137
cd00123286 cd00123, DmpA_OAT, DmpA/OAT superfamily; composed of L- 9e-08
>gnl|CDD|180051 PRK05388, argJ, bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein; Validated Back     alignment and domain information
>gnl|CDD|73147 cd02152, OAT, Ornithine acetyltransferase (OAT) family; also referred to as ArgJ Back     alignment and domain information
>gnl|CDD|31555 COG1364, ArgJ, N-acetylglutamate synthase (N-acetylornithine aminotransferase) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|161718 TIGR00120, ArgJ, glutamate N-acetyltransferase/amino-acid acetyltransferase Back     alignment and domain information
>gnl|CDD|37997 KOG2786, KOG2786, KOG2786, Putative glutamate/ornithine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|145242 pfam01960, ArgJ, ArgJ family Back     alignment and domain information
>gnl|CDD|73146 cd00123, DmpA_OAT, DmpA/OAT superfamily; composed of L-aminopeptidase D-amidase/D-esterase (DmpA), ornithine acetyltransferase (OAT) and similar proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 416 bifunctional ornithine acetyltransferase/N-acetylglutam
PRK05388404 argJ bifunctional ornithine acetyltransferase/N-acetylg 100.0
pfam01960387 ArgJ ArgJ family. Members of the ArgJ family catalyse t 100.0
cd02152390 OAT Ornithine acetyltransferase (OAT) family; also refe 100.0
COG1364404 ArgJ N-acetylglutamate synthase (N-acetylornithine amin 100.0
KOG2786431 consensus 100.0
TIGR00120430 ArgJ arginine biosynthesis bifunctional protein ArgJ; I 100.0
cd00123286 DmpA_OAT DmpA/OAT superfamily; composed of L-aminopepti 100.0
cd02253339 DmpA L-Aminopeptidase D-amidase/D-esterase (DmpA) famil 95.59
pfam03576323 Peptidase_S58 Peptidase family S58. 92.84
COG3191348 DmpA L-aminopeptidase/D-esterase [Amino acid transport 94.5
>PRK05388 argJ bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein; Validated Back     alignment and domain information
>pfam01960 ArgJ ArgJ family Back     alignment and domain information
>cd02152 OAT Ornithine acetyltransferase (OAT) family; also referred to as ArgJ Back     alignment and domain information
>COG1364 ArgJ N-acetylglutamate synthase (N-acetylornithine aminotransferase) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2786 consensus Back     alignment and domain information
>TIGR00120 ArgJ arginine biosynthesis bifunctional protein ArgJ; InterPro: IPR002813 ArgJ is a bifunctional protein that catalyses the first 2 Back     alignment and domain information
>cd00123 DmpA_OAT DmpA/OAT superfamily; composed of L-aminopeptidase D-amidase/D-esterase (DmpA), ornithine acetyltransferase (OAT) and similar proteins Back     alignment and domain information
>cd02253 DmpA L-Aminopeptidase D-amidase/D-esterase (DmpA) family; DmpA catalyzes the release of N-terminal D and L amino acids from peptide susbtrates Back     alignment and domain information
>pfam03576 Peptidase_S58 Peptidase family S58 Back     alignment and domain information
>COG3191 DmpA L-aminopeptidase/D-esterase [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
1vz6_A393 Ornithine Acetyltransferase (Orf6 Gene Product- Cla 3e-82
1vz8_A393 Ornithine Acetyltransferase (Orf6 Gene Product- Cla 6e-79
1vra_B215 Crystal Structure Of Arginine Biosynthesis Bifuncti 3e-48
2vzk_B213 Structure Of The Acyl-Enzyme Complex Of An N-Termin 4e-43
2vzk_D213 Structure Of The Acyl-Enzyme Complex Of An N-Termin 7e-43
2w4n_B213 Structure Of An N-Terminal Nucleophile (Ntn) Hydrol 2e-42
3it4_B205 The Crystal Structure Of Ornithine Acetyltransferas 1e-35
1vra_A208 Crystal Structure Of Arginine Biosynthesis Bifuncti 2e-32
3it4_A199 The Crystal Structure Of Ornithine Acetyltransferas 3e-32
2vzk_A173 Structure Of The Acyl-Enzyme Complex Of An N-Termin 8e-29
gi|55670479|pdb|1VZ6|A Chain A, Ornithine Acetyltransferase (Orf6 Gene Product- Clavulanic Acid Biosynthesis) From Streptomyces Clavuligerus Length = 393 Back     alignment and structure
 Score =  310 bits (794), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 137/409 (33%), Positives = 210/409 (51%), Gaps = 22/409 (5%)

Query: 13  SHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKG 72
           S  +P     +G  +  A +G+   GRDD  ++    PA+V+ VFTRS      V  C+ 
Sbjct: 2   SDSTPKTP--RGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCRE 59

Query: 73  NLSHGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLD 132
            ++ G AR ++V +  AN  TG  G +  R + +AV+  +   E E+ +ASTG+IG    
Sbjct: 60  AVADGQARGVVVLARNANVATGLEGEENAREVREAVARALGLPEGEMLIASTGVIGRQYP 119

Query: 133 VALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMI 192
           +      L  +   A +  +  +A+A+MTTD   K    +V       T+ G+AKG GM+
Sbjct: 120 MESIREHLKTLEWPAGEGGFDRAARAIMTTDTRPKEVRVSV----GGATLVGIAKGVGML 175

Query: 193 APDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGN 252
            PDMAT L F  TD  + PA    +     + +FN++++D DTSTSDT +LFA G     
Sbjct: 176 EPDMATLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLA--- 232

Query: 253 FAPITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALS 312
                   +     F  AL      L   +  DGEGA+KL+EV V GA D A AK+V  +
Sbjct: 233 -------GEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKT 285

Query: 313 IANSPLVKTAFASESFGWWGRIVMAVGKS--GVLVDRDRLSVWFGDVRIA---NNGEPEI 367
           + NSPLVKTA        WGR+ MA+GK      +D++R+++ FG+V +      G+   
Sbjct: 286 VVNSPLVKTAVHGCDPN-WGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQAD 344

Query: 368 NFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSNVQS 416
           +  + +V   ++   V I +DL I +G  TV+ CD ++ Y+  NS   +
Sbjct: 345 DALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT 393


>gi|55670485|pdb|1VZ8|A Chain A, Ornithine Acetyltransferase (Orf6 Gene Product- Clavulanic Acid Biosynthesis) From Streptomyces Clavuligerus (Semet Structure) Length = 393 Back     alignment and structure
>gi|66360302|pdb|1VRA|B Chain B, Crystal Structure Of Arginine Biosynthesis Bifunctional Protein Argj (10175521) From Bacillus Halodurans At 2.00 A Resolution Length = 215 Back     alignment and structure
>gi|203282331|pdb|2VZK|B Chain B, Structure Of The Acyl-Enzyme Complex Of An N-Terminal Nucleophile (Ntn) Hydrolase, Oat2 Length = 213 Back     alignment and structure
>gi|203282333|pdb|2VZK|D Chain D, Structure Of The Acyl-Enzyme Complex Of An N-Terminal Nucleophile (Ntn) Hydrolase, Oat2 Length = 213 Back     alignment and structure
>gi|281500619|pdb|2W4N|B Chain B, Structure Of An N-Terminal Nucleophile (Ntn) Hydrolase, Oat2, In Complex With Glutamate Length = 213 Back     alignment and structure
>gi|290560238|pdb|3IT4|B Chain B, The Crystal Structure Of Ornithine Acetyltransferase From Mycobacterium Tuberculosis (Rv1653) At 1.7 A Length = 205 Back     alignment and structure
>gi|66360301|pdb|1VRA|A Chain A, Crystal Structure Of Arginine Biosynthesis Bifunctional Protein Argj (10175521) From Bacillus Halodurans At 2.00 A Resolution Length = 208 Back     alignment and structure
>gi|290560237|pdb|3IT4|A Chain A, The Crystal Structure Of Ornithine Acetyltransferase From Mycobacterium Tuberculosis (Rv1653) At 1.7 A Length = 199 Back     alignment and structure
>gi|203282330|pdb|2VZK|A Chain A, Structure Of The Acyl-Enzyme Complex Of An N-Terminal Nucleophile (Ntn) Hydrolase, Oat2 Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
1vz6_A393 Ornithine acetyl-transferase; clavulanic acid, N-acetyl 1e-75
3it4_B205 Arginine biosynthesis bifunctional protein ARGJ beta ch 3e-50
1vra_B215 Arginine biosynthesis bifunctional protein ARGJ; 101755 3e-44
2v4i_B213 Glutamate N-acetyltransferase 2 beta chain; cytoplasm, 4e-40
1vra_A208 Arginine biosynthesis bifunctional protein ARGJ; 101755 1e-45
3it4_A199 Arginine biosynthesis bifunctional protein ARGJ alpha c 9e-41
2v4i_A173 Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, 2e-37
>1vz6_A Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus} SCOP: d.154.1.2 PDB: 1vz7_A 1vz8_A Length = 393 Back     alignment and structure
 Score =  278 bits (713), Expect = 1e-75
 Identities = 137/402 (34%), Positives = 208/402 (51%), Gaps = 21/402 (5%)

Query: 16  SPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLS 75
           S    P +G  +  A +G+   GRDD  ++    PA+V+ VFTRS      V  C+  ++
Sbjct: 4   STPKTP-RGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVA 62

Query: 76  HGIARALIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVAL 135
            G AR ++V +  AN  TG  G +  R + +AV+  +   E E+ +ASTG+IG    +  
Sbjct: 63  DGQARGVVVLARNANVATGLEGEENAREVREAVARALGLPEGEMLIASTGVIGRQYPMES 122

Query: 136 FDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPD 195
               L  +   A +  +  +A+A+MTTD       + V +     T+ G+AKG GM+ PD
Sbjct: 123 IREHLKTLEWPAGEGGFDRAARAIMTTDTR----PKEVRVSVGGATLVGIAKGVGMLEPD 178

Query: 196 MATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAP 255
           MAT L F  TD  + PA    +     + +FN++++D DTSTSDT +LFA G      A 
Sbjct: 179 MATLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAG 238

Query: 256 ITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIAN 315
                      F  AL      L   +  DGEGA+KL+EV V GA D A AK+V  ++ N
Sbjct: 239 E----------FEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVN 288

Query: 316 SPLVKTAFASESFGWWGRIVMAVGKS--GVLVDRDRLSVWFGDVRIA---NNGEPEINFS 370
           SPLVKTA        WGR+ MA+GK      +D++R+++ FG+V +      G+   +  
Sbjct: 289 SPLVKTAVHGCDPN-WGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDAL 347

Query: 371 QESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNS 412
           + +V   ++   V I +DL I +G  TV+ CD ++ Y+  NS
Sbjct: 348 RAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNS 389


>3it4_B Arginine biosynthesis bifunctional protein ARGJ beta chain; ornithine acetyltransferase, structural genomics; 1.70A {Mycobacterium tuberculosis} PDB: 3it6_B Length = 205 Back     alignment and structure
>1vra_B Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Length = 215 Back     alignment and structure
>2v4i_B Glutamate N-acetyltransferase 2 beta chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_D* 2vzk_B* Length = 213 Back     alignment and structure
>1vra_A Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Length = 208 Back     alignment and structure
>3it4_A Arginine biosynthesis bifunctional protein ARGJ alpha chain; ornithine acetyltransferase, structural genomics; 1.70A {Mycobacterium tuberculosis} PDB: 3it6_A Length = 199 Back     alignment and structure
>2v4i_A Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_A* Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
1vz6_A393 Ornithine acetyl-transferase; clavulanic acid, N-acetyl 100.0
1vra_B215 Arginine biosynthesis bifunctional protein ARGJ; 101755 100.0
3it4_B205 Arginine biosynthesis bifunctional protein ARGJ beta ch 100.0
2v4i_B213 Glutamate N-acetyltransferase 2 beta chain; cytoplasm, 100.0
1vra_A208 Arginine biosynthesis bifunctional protein ARGJ; 101755 100.0
2v4i_A173 Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, 100.0
3it4_A199 Arginine biosynthesis bifunctional protein ARGJ alpha c 100.0
1b65_A375 DMPA, protein (aminopeptidase); hydrolase, peptide degr 92.87
>1vz6_A Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus} SCOP: d.154.1.2 PDB: 1vz7_A 1vz8_A Back     alignment and structure
Probab=100.00  E-value=0  Score=1109.00  Aligned_cols=384  Identities=35%  Similarity=0.538  Sum_probs=366.9

Q ss_pred             CCCCCCCCCEEEEEEEECCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCH
Q ss_conf             89878747479999980310188946999994899869998325778534348888872358802999937872234147
Q gi|254780326|r   16 SPVLLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGK   95 (416)
Q Consensus        16 ~p~l~~i~Gf~~~~~~aGiK~~~r~DL~li~~~~pa~~AgvFT~N~~~AAPV~~~k~~l~~~~~raivvNSGnANA~TG~   95 (416)
                      .|.+|  +||++++++||||+++|+||+||+++.||++|||||+|+|+||||+|||++++++++|+|||||||||||||+
T Consensus         5 ~~~~P--~Gf~~~~~~aGiK~~gr~Dlali~s~~p~~~AgvFT~N~~~AAPV~~~~~~l~~~~~ravvvNSGnANA~TG~   82 (393)
T 1vz6_A            5 TPKTP--RGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARGVVVLARNANVATGL   82 (393)
T ss_dssp             ---CC--TTEEEEEECCCSSTTCCCCEEEEEESSCCEEEEEECCCTTCCHHHHHHHHHTTTSBCCEEEEEEEECCCSCHH
T ss_pred             CCCCC--CCEEEEEEEECCCCCCCCCEEEEEECCCCEEEEEECCCCCEECCCHHHHHHHHCCCCEEEEEEECCCCCCCCH
T ss_conf             98999--8679999994245799985899996899769999625875305849989975048845999960742155578


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEE
Q ss_conf             98999999999998764987330887114310224320222210012223458322688887643156575224668875
Q gi|254780326|r   96 RGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDI  175 (416)
Q Consensus        96 ~G~~~a~~~~~~~a~~l~~~~~~Vl~~STGVIG~~Lp~~ki~~~i~~l~~~l~~~~~~~aA~AImTTDt~pK~~~~~~~i  175 (416)
                      +|++|+++|++.+|+.|+|++++||++||||||+||||++|+++||++..++++++|.+||+||||||||||...    +
T Consensus        83 ~G~~~a~~~~~~~a~~l~~~~~~Vlv~STGVIG~~Lp~~~i~~~i~~~~~~l~~~~~~~aA~AImTTDt~pK~~~----~  158 (393)
T 1vz6_A           83 EGEENAREVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLKTLEWPAGEGGFDRAARAIMTTDTRPKEVR----V  158 (393)
T ss_dssp             HHHHHHHHHHHHHHHHHTCCGGGEEEEEEEESSCCCCHHHHHHHHTTCCCCSSSBCHHHHHHHTCSSCSSCEEEE----E
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHEEEECCCHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCEEEEE----E
T ss_conf             899999999999999849994037884030213658678999987654304586179999988856785057899----9


Q ss_pred             CCCEEEEEEEEECCHHCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEEEEECCCCCCCCCC
Q ss_conf             69628999985020002434522588999656439999999999860055541431676564422899632653467777
Q gi|254780326|r  176 DGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAP  255 (416)
Q Consensus       176 ~g~~v~i~GiaKGsGMI~PnMATML~fi~TDa~i~~~~L~~~L~~~v~~SFN~IsVDGDtSTNDtv~l~AnG~~~~~~~~  255 (416)
                      +++.++|.|||||||||||||||||+||||||+|+++.||++|+++|++|||||||||||||||||++||||+++     
T Consensus       159 ~~~~~~i~GiaKGsGMI~PnMATML~fi~TDa~i~~~~L~~~L~~av~~SFN~IsVDGDtSTNDtv~llAnG~~~-----  233 (393)
T 1vz6_A          159 SVGGATLVGIAKGVGMLEPDMATLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAG-----  233 (393)
T ss_dssp             EETTEEEEEEEECSSSCCCCCCCCEEEEEEEEECCHHHHHHHHHHHHHHTGGGBCSSSCCCSSCEEEEEEEEEEE-----
T ss_pred             EECCCEEEEEEECCCCCCCCHHHEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCEEEEEECCCCC-----
T ss_conf             610437999973253458753114788997466798999999998776123637756887777589998338877-----


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHH
Q ss_conf             68887777998888788999999998622630021379999824899999999987735715665555067886244532
Q gi|254780326|r  256 ITDVSDKRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIV  335 (416)
Q Consensus       256 i~~~~~~~~~~f~~aL~~v~~~LA~~Iv~DGEGatk~i~v~V~gA~~~~~A~~ia~sIa~S~LvKtA~~G~DpN~WGRI~  335 (416)
                           ++++.+|+++|.++|++||+|||||||||||||+|+|+||+|+.+|++|||+|+||||||||+||+||| ||||+
T Consensus       234 -----~~~~~~f~~aL~~v~~~LA~~Iv~DGEGATKli~v~V~gA~s~~~A~~vA~sIa~S~LVKTAi~G~DpN-WGRI~  307 (393)
T 1vz6_A          234 -----EVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPN-WGRVA  307 (393)
T ss_dssp             -----ECCHHHHHHHHHHHHHHHHHHHHHTCTTCSSEEEEEEEEESSHHHHHHHHHHHHTCHHHHHHHHTTCCC-HHHHH
T ss_pred             -----CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHCCCCC-HHHHH
T ss_conf             -----532899999999999999999752622043379999915899999999999975488899998376998-79999


Q ss_pred             HHHCCCC--CCCCHHHEEEEECCEEEEECCCC---CCCCCHHHHHHHHCCCCEEEEEECCCCCEEEEEEECCCCHHHEEC
Q ss_conf             2202457--76582334999899998717731---878899999986254877999972689812899954587546001
Q gi|254780326|r  336 MAVGKSG--VLVDRDRLSVWFGDVRIANNGEP---EINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHF  410 (416)
Q Consensus       336 aAiG~sg--~~~d~~~i~i~ig~~~v~~~G~~---~~~~~e~~~~~~~~~~~i~i~idLg~G~~~~t~~tcDLt~~YV~i  410 (416)
                      ||+||++  ++|||++++|+||+++|+++|.+   ..+|+|++++++|+++||.|.||||.|++++++||||||||||+|
T Consensus       308 ~AiG~sg~~~~~d~~~v~i~~g~~~v~~~g~~~~~~~~~~e~~~~~~m~~~ei~I~vdL~~G~~~at~wtcDLt~~YV~I  387 (393)
T 1vz6_A          308 MAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRL  387 (393)
T ss_dssp             HHHHTCTTCTTCCTTTCEEEETTEEEECC-------CHHHHHHHHHHTTSSEEEEEEECCSSSEEEEEEEECCCHHHHHH
T ss_pred             HHHCCCCCCCCCCHHEEEEEECCEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEECCCCHHHHEE
T ss_conf             77412456677771207999899999962677887735669999987567918999997888821899927698668348


Q ss_pred             CCCCCC
Q ss_conf             146579
Q gi|254780326|r  411 NSNVQS  416 (416)
Q Consensus       411 Na~Yrs  416 (416)
                      ||||||
T Consensus       388 Na~YrT  393 (393)
T 1vz6_A          388 NSEYTT  393 (393)
T ss_dssp             HHC---
T ss_pred             CCCCCC
T ss_conf             775589



>1vra_B Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Back     alignment and structure
>3it4_B Arginine biosynthesis bifunctional protein ARGJ beta chain; ornithine acetyltransferase, structural genomics; 1.70A {Mycobacterium tuberculosis} PDB: 3it6_B Back     alignment and structure
>2v4i_B Glutamate N-acetyltransferase 2 beta chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_D* 2vzk_B* 2w4n_B* Back     alignment and structure
>1vra_A Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Back     alignment and structure
>2v4i_A Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_A* 2w4n_A* Back     alignment and structure
>3it4_A Arginine biosynthesis bifunctional protein ARGJ alpha chain; ornithine acetyltransferase, structural genomics; 1.70A {Mycobacterium tuberculosis} PDB: 3it6_A Back     alignment and structure
>1b65_A DMPA, protein (aminopeptidase); hydrolase, peptide degradation, NTN hydrolase; 1.82A {Ochrobactrum anthropi} SCOP: d.154.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 416 bifunctional ornithine acetyltransferase/N-acetylglutam
d1vz6a_383 d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithi 4e-79
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Length = 383 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DmpA/ArgJ-like
superfamily: DmpA/ArgJ-like
family: ArgJ-like
domain: Glutamate N-acetyltransferase 2 (ornithine acetyltransferase)
species: Streptomyces clavuligerus [TaxId: 1901]
 Score =  288 bits (739), Expect = 4e-79
 Identities = 135/395 (34%), Positives = 205/395 (51%), Gaps = 20/395 (5%)

Query: 23  KGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARAL 82
           +G  +  A +G+   GRDD  ++    PA+V+ VFTRS      V  C+  ++ G AR +
Sbjct: 3   RGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARGV 62

Query: 83  IVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSK 142
           +V +  AN  TG  G +  R + +AV+  +   E E+ +ASTG+IG    +      L  
Sbjct: 63  VVLARNANVATGLEGEENAREVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLKT 122

Query: 143 MLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAF 202
           +   A +  +  +A+A+MTTD       + V +     T+ G+AKG GM+ PDMAT L F
Sbjct: 123 LEWPAGEGGFDRAARAIMTTDTR----PKEVRVSVGGATLVGIAKGVGMLEPDMATLLTF 178

Query: 203 VVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDK 262
             TD  + PA    +     + +FN++++D DTSTSDT +LFA G      A        
Sbjct: 179 FATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGE------ 232

Query: 263 RLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTA 322
               F  AL      L   +  DGEGA+KL+EV V GA D A AK+V  ++ NSPLVKTA
Sbjct: 233 ----FEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTA 288

Query: 323 FASESFGWWGRIVMAVGKSGVLV--DRDRLSVWFGDVRIA---NNGEPEINFSQESVRSI 377
                   WGR+ MA+GK       D++R+++ FG+V +      G+   +  + +V   
Sbjct: 289 VHGCDPN-WGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEH 347

Query: 378 VKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNS 412
           ++   V I +DL I +G  TV+ CD ++ Y+  NS
Sbjct: 348 LRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNS 382


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
d1vz6a_383 Glutamate N-acetyltransferase 2 (ornithine acetyltransf 100.0
d1b65a_367 L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobact 93.21
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DmpA/ArgJ-like
superfamily: DmpA/ArgJ-like
family: ArgJ-like
domain: Glutamate N-acetyltransferase 2 (ornithine acetyltransferase)
species: Streptomyces clavuligerus [TaxId: 1901]
Probab=100.00  E-value=0  Score=1077.67  Aligned_cols=377  Identities=35%  Similarity=0.540  Sum_probs=361.8

Q ss_pred             CCCEEEEEEEECCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHH
Q ss_conf             47479999980310188946999994899869998325778534348888872358802999937872234147989999
Q gi|254780326|r   22 IKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTV  101 (416)
Q Consensus        22 i~Gf~~~~~~aGiK~~~r~DL~li~~~~pa~~AgvFT~N~~~AAPV~~~k~~l~~~~~raivvNSGnANA~TG~~G~~~a  101 (416)
                      ++||++++++||||+++|+||+||++++||++|||||+|+|+||||+|||++++++++|+|||||||||||||++|++++
T Consensus         2 PkGf~~~~~~aGiK~~~r~DL~li~~~~~~~~AgvFT~N~~~AApV~~~r~~l~~~~~ravvvNSGnANA~TG~~G~~~a   81 (383)
T d1vz6a_           2 PRGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARGVVVLARNANVATGLEGEENA   81 (383)
T ss_dssp             CTTEEEEEECCCSSTTCCCCEEEEEESSCCEEEEEECCCTTCCHHHHHHHHHTTTSBCCEEEEEEEECCCSCHHHHHHHH
T ss_pred             CCCEEEEEEEECCCCCCCCCEEEEEECCCCEEEEEECCCCCEECCCHHHHHHHCCCCCEEEEEECCCHHHHCCHHHHHHH
T ss_conf             98599999995366799986899995799769999736875301519989875268842999953741111158889999


Q ss_pred             HHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEECCCEEE
Q ss_conf             99999998764987330887114310224320222210012223458322688887643156575224668875696289
Q gi|254780326|r  102 RFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVT  181 (416)
Q Consensus       102 ~~~~~~~a~~l~~~~~~Vl~~STGVIG~~Lp~~ki~~~i~~l~~~l~~~~~~~aA~AImTTDt~pK~~~~~~~i~g~~v~  181 (416)
                      ++|++.+|+.|+|++++||++|||||||+||+++|+++||++..++++++|++||+||||||||||.+.    ++++.++
T Consensus        82 ~~~~~~~A~~l~i~~~~Vl~aSTGVIG~~Lp~~kI~~~i~~l~~~l~~~~~~~AA~AImTTDt~pK~~~----i~~~~~~  157 (383)
T d1vz6a_          82 REVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLKTLEWPAGEGGFDRAARAIMTTDTRPKEVR----VSVGGAT  157 (383)
T ss_dssp             HHHHHHHHHHHTCCGGGEEEEEEEESSCCCCHHHHHHHHTTCCCCSSSBCHHHHHHHTCSSCSSCEEEE----EEETTEE
T ss_pred             HHHHHHHHHHCCCCCCCEEEECCCHHHCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEE----EEECCCE
T ss_conf             999987655304575314551242010146411334433211223234336654445306642025899----9720424


Q ss_pred             EEEEEECCHHCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             99985020002434522588999656439999999999860055541431676564422899632653467777688877
Q gi|254780326|r  182 INGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSD  261 (416)
Q Consensus       182 i~GiaKGsGMI~PnMATML~fi~TDa~i~~~~L~~~L~~~v~~SFN~IsVDGDtSTNDtv~l~AnG~~~~~~~~i~~~~~  261 (416)
                      |.|||||||||||||||||+||||||.|+++.||++|++++++|||+|||||||||||||++||||.++.          
T Consensus       158 i~GiaKGsGMI~PnMATML~fi~TDa~i~~~~L~~~l~~~v~~sFN~ItVDGDtSTNDtv~~lAnG~~~~----------  227 (383)
T d1vz6a_         158 LVGIAKGVGMLEPDMATLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGE----------  227 (383)
T ss_dssp             EEEEEECSSSCCCCCCCCEEEEEEEEECCHHHHHHHHHHHHHHTGGGBCSSSCCCSSCEEEEEEEEEEEE----------
T ss_pred             EEEEEECCHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCC----------
T ss_conf             7778601432055545247899961556768899999986414500065458888775899984587532----------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHHHHCCC
Q ss_conf             77998888788999999998622630021379999824899999999987735715665555067886244532220245
Q gi|254780326|r  262 KRLSLFRPALFDLLKDLALQVVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGKS  341 (416)
Q Consensus       262 ~~~~~f~~aL~~v~~~LA~~Iv~DGEGatk~i~v~V~gA~~~~~A~~ia~sIa~S~LvKtA~~G~DpN~WGRI~aAiG~s  341 (416)
                      +++.+|+++|.++|++||++||||||||||||+|+|+||+|+++|+++||+|+||||||||+||+||| ||||+||+||+
T Consensus       228 ~~~~~f~~aL~~v~~~LA~~Iv~DGEGATK~i~v~V~gA~s~~dA~~iAr~ia~S~LVKtA~~G~DpN-WGRI~aAiG~~  306 (383)
T d1vz6a_         228 VDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPN-WGRVAMAIGKC  306 (383)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHTCTTCSSEEEEEEEEESSHHHHHHHHHHHHTCHHHHHHHHTTCCC-HHHHHHHHHTC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHCCC
T ss_conf             10787777788999999999863653322589999805899999999999975229999887345884-77777664235


Q ss_pred             C--CCCCHHHEEEEECCEEEEECCC---CCCCCCHHHHHHHHCCCCEEEEEECCCCCEEEEEEECCCCHHHEECCCC
Q ss_conf             7--7658233499989999871773---1878899999986254877999972689812899954587546001146
Q gi|254780326|r  342 G--VLVDRDRLSVWFGDVRIANNGE---PEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVWTCDFSKEYIHFNSN  413 (416)
Q Consensus       342 g--~~~d~~~i~i~ig~~~v~~~G~---~~~~~~e~~~~~~~~~~~i~i~idLg~G~~~~t~~tcDLt~~YV~iNa~  413 (416)
                      +  ++|||++++|++|+++++++|.   ...+|+|++++++|+++||+|.||||.|++++++||||||||||+||||
T Consensus       307 ~~~~~~d~~~i~i~~~~~~v~~~g~~~~~~~~~~~~~~~~~m~~~ei~I~vdL~~G~~~~~~wtcDLt~~YV~INad  383 (383)
T d1vz6a_         307 SDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSE  383 (383)
T ss_dssp             TTCTTCCTTTCEEEETTEEEECC-------CHHHHHHHHHHTTSSEEEEEEECCSSSEEEEEEEECCCHHHHHHHHC
T ss_pred             CCCCCCCHHHEEEEECCEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEECCCCCCHHCCCCC
T ss_conf             67766662425999899999963667887733559999987457848999997888922899907698322102689



>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 416 bifunctional ornithine acetyltransferase/N-acetylg
1vz6_A_1-261261 (A:1-261) Ornithine acetyl-transferase; clavulanic 7e-76
1vra_B_1-202202 (B:1-202) Arginine biosynthesis bifunctional prote 2e-58
2v4i_B_1-200200 (B:1-200) Glutamate N-acetyltransferase 2 beta cha 2e-54
2v4i_A_173 (A:) Glutamate N-acetyltransferase 2 alpha chain; 1e-51
1vra_A_31-174144 (A:31-174) Arginine biosynthesis bifunctional prot 6e-38
1vz6_A_262-380119 (A:262-380) Ornithine acetyl-transferase; clavulan 7e-30
1vra_A_1-30_175-20864 (A:1-30,A:175-208) Arginine biosynthesis bifunctio 3e-07
>1vz6_A (A:1-261) Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus}Length = 261 Back     alignment and structure
 Score =  278 bits (713), Expect = 7e-76
 Identities = 86/267 (32%), Positives = 130/267 (48%), Gaps = 14/267 (5%)

Query: 22  IKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARA 81
            +G  +  A +G+   GRDD  ++    PA+V+ VFTRS      V  C+  ++ G AR 
Sbjct: 9   PRGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARG 68

Query: 82  LIVNSGIANAFTGKRGRDTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLS 141
           ++V +  AN  TG  G +  R + +AV+  +   E E+ +ASTG+IG    +      L 
Sbjct: 69  VVVLARNANVATGLEGEENAREVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLK 128

Query: 142 KMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLA 201
            +   A +  +  +A+A+MTTD   K       +     T+ G+AKG GM+ PDMAT L 
Sbjct: 129 TLEWPAGEGGFDRAARAIMTTDTRPKEVR----VSVGGATLVGIAKGVGMLEPDMATLLT 184

Query: 202 FVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSD 261
           F  TD  + PA    +     + +FN++++D DTSTSDT +LFA G             +
Sbjct: 185 FFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGL----------AGE 234

Query: 262 KRLSLFRPALFDLLKDLALQVVCDGEG 288
                F  AL      L   +  DGEG
Sbjct: 235 VDAGEFEEALHTAALALVKDIASDGEG 261


>1vra_B (B:1-202) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans}Length = 202 Back     alignment and structure
>2v4i_B (B:1-200) Glutamate N-acetyltransferase 2 beta chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_D* 2vzk_B*Length = 200 Back     alignment and structure
>2v4i_A (A:) Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_A*Length = 173 Back     alignment and structure
>1vra_A (A:31-174) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans}Length = 144 Back     alignment and structure
>1vz6_A (A:262-380) Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus}Length = 119 Back     alignment and structure
>1vra_A (A:1-30,A:175-208) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans}Length = 64 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 bifunctional ornithine acetyltransferase/N-acetylglutam
1vz6_A_1-261261 Ornithine acetyl-transferase; clavulanic acid, N-a 100.0
1vra_B_1-202202 Arginine biosynthesis bifunctional protein ARGJ; 1 100.0
2v4i_B_1-200200 Glutamate N-acetyltransferase 2 beta chain; cytopl 100.0
2v4i_A_173 Glutamate N-acetyltransferase 2 alpha chain; cytop 100.0
1vra_A_31-174144 Arginine biosynthesis bifunctional protein ARGJ; 1 100.0
1vz6_A_262-380119 Ornithine acetyl-transferase; clavulanic acid, N-a 100.0
1vra_A_1-30_175-20864 Arginine biosynthesis bifunctional protein ARGJ; 1 99.32
1b65_A_70-101_178-375230 DMPA, protein (aminopeptidase); hydrolase, peptide 96.5
2drh_A_361 PH0078 protein, 361AA long hypothetical D-aminopep 93.12
>1vz6_A (A:1-261) Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus} Back     alignment and structure
Probab=100.00  E-value=0  Score=725.69  Aligned_cols=256  Identities=34%  Similarity=0.482  Sum_probs=248.1

Q ss_pred             CCCCCCEEEEEEEECCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHH
Q ss_conf             78747479999980310188946999994899869998325778534348888872358802999937872234147989
Q gi|254780326|r   19 LLPIKGVRLSAAALGIKYVGRDDVFLMVFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGR   98 (416)
Q Consensus        19 l~~i~Gf~~~~~~aGiK~~~r~DL~li~~~~pa~~AgvFT~N~~~AAPV~~~k~~l~~~~~raivvNSGnANA~TG~~G~   98 (416)
                      +..++||++++++||||+++|+||+||+++.||++|||||||+|+||||+|||++++++++|+|||||||||||||++|+
T Consensus         6 v~~P~Gf~~~g~~aGiK~~~r~Dlali~s~~pa~~AgvFT~N~~~AAPV~~~~~~l~~~~~ravvvNSGnANA~TG~~G~   85 (261)
T 1vz6_A            6 PKTPRGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARGVVVLARNANVATGLEGE   85 (261)
T ss_dssp             --CCTTEEEEEECCCSSTTCCCCEEEEEESSCCEEEEEECCCTTCCHHHHHHHHHTTTSBCCEEEEEEEECCCSCHHHHH
T ss_pred             CCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEEEEECCCCCCCCHHHHH
T ss_conf             89998489999995355699986899996899669999725875203639999875068840899943874434537799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEECCC
Q ss_conf             99999999998764987330887114310224320222210012223458322688887643156575224668875696
Q gi|254780326|r   99 DTVRFIAKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTDRYAKVAVRTVDIDGI  178 (416)
Q Consensus        99 ~~a~~~~~~~a~~l~~~~~~Vl~~STGVIG~~Lp~~ki~~~i~~l~~~l~~~~~~~aA~AImTTDt~pK~~~~~~~i~g~  178 (416)
                      +|+++|++.+|+.|+|++++||++||||||+|||||+|+.+||++..+++.++|++||+||||||||||.+.+    +|+
T Consensus        86 ~da~~~~~~~A~~l~~~~~~Vl~~STGvIG~~lp~dki~~~i~~l~~~l~~~~~~~aA~AImTTDt~pK~~~i----~g~  161 (261)
T 1vz6_A           86 ENAREVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLKTLEWPAGEGGFDRAARAIMTTDTRPKEVRV----SVG  161 (261)
T ss_dssp             HHHHHHHHHHHHHHTCCGGGEEEEEEEESSCCCCHHHHHHHHTTCCCCSSSBCHHHHHHHTCSSCSSCEEEEE----EET
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEECCCHHHCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCEEEEEE----EEC
T ss_conf             9999999764233243763155402301211464124444333112455753577765675067531037899----613


Q ss_pred             EEEEEEEEECCHHCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEEEEECCCCCCCCCCCCC
Q ss_conf             28999985020002434522588999656439999999999860055541431676564422899632653467777688
Q gi|254780326|r  179 RVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGAEYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITD  258 (416)
Q Consensus       179 ~v~i~GiaKGsGMI~PnMATML~fi~TDa~i~~~~L~~~L~~~v~~SFN~IsVDGDtSTNDtv~l~AnG~~~~~~~~i~~  258 (416)
                      +++|+|||||||||||||||||+||+|||.|+++.||++|++++++|||+|||||||||||||++||||+++        
T Consensus       162 ~~~i~GiaKGsGMI~PnMATML~fi~TDA~i~~~~L~~~L~~~v~~SFN~ItVDGDtSTNDtvlllAnG~a~--------  233 (261)
T 1vz6_A          162 GATLVGIAKGVGMLEPDMATLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAG--------  233 (261)
T ss_dssp             TEEEEEEEECSSSCCCCCCCCEEEEEEEEECCHHHHHHHHHHHHHHTGGGBCSSSCCCSSCEEEEEEEEEEE--------
T ss_pred             CCEEEEEEECCHHHCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCC--------
T ss_conf             743788961054205431000789998235676889999998641450006535888877579999548755--------


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             877779988887889999999986226300
Q gi|254780326|r  259 VSDKRLSLFRPALFDLLKDLALQVVCDGEG  288 (416)
Q Consensus       259 ~~~~~~~~f~~aL~~v~~~LA~~Iv~DGEG  288 (416)
                        .+++.+|+++|.+||++||+||||||||
T Consensus       234 --~~~~~~f~~aL~~v~~~LAk~Iv~DGEG  261 (261)
T 1vz6_A          234 --EVDAGEFEEALHTAALALVKDIASDGEG  261 (261)
T ss_dssp             --ECCHHHHHHHHHHHHHHHHHHHHHTCTT
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             --2108899999999999999998736544



>1vra_B (B:1-202) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Back     alignment and structure
>2v4i_B (B:1-200) Glutamate N-acetyltransferase 2 beta chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_D* 2vzk_B* Back     alignment and structure
>2v4i_A (A:) Glutamate N-acetyltransferase 2 alpha chain; cytoplasm, acyl enzyme, NTN hydrolase, acyltransferase, ornithine acetyl transferase; 2.2A {Streptomyces clavuligerus} PDB: 2vzk_A* Back     alignment and structure
>1vra_A (A:31-174) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Back     alignment and structure
>1vz6_A (A:262-380) Ornithine acetyl-transferase; clavulanic acid, N-acetyl- ornithine, N-acetyl-glutamate, antibiotic; 2.75A {Streptomyces clavuligerus} Back     alignment and structure
>1vra_A (A:1-30,A:175-208) Arginine biosynthesis bifunctional protein ARGJ; 10175521, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.00A {Bacillus halodurans} Back     alignment and structure
>1b65_A (A:70-101,A:178-375) DMPA, protein (aminopeptidase); hydrolase, peptide degradation, NTN hydrolase; 1.82A {Ochrobactrum anthropi} Back     alignment and structure
>2drh_A (A:) PH0078 protein, 361AA long hypothetical D-aminopeptidase; structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure