254780338

254780338

hypothetical protein CLIBASIA_01115

GeneID in NCBI database:8209323Locus tag:CLIBASIA_01115
Protein GI in NCBI database:254780338Protein Accession:YP_003064751.1
Gene range:-(233782, 234171)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:[O] Disulfide bond formation protein DsbB
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcc
cccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcc
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHilpgdlgysipvfgMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECgltqcfdnptfyqlln
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWslifslviilfisvlMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN
MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_01115 [Candidatus Liberib
284007427151 conserved hypothetical protein [Arsenophonus nasoniae] 1 4e-37
37524258189 hypothetical protein plu0239 [Photorhabdus luminescens 1 1e-32
253987664189 hypothetical protein PAU_00181 [Photorhabdus asymbiotic 1 2e-31
300724708188 hypothetical protein XNC1_3917 [Xenorhabdus nematophila 1 8e-31
290476875184 hypothetical protein XBJ1_3906 [Xenorhabdus bovienii SS 1 8e-30
238919044189 hypothetical protein NT01EI_1112 [Edwardsiella ictaluri 1 2e-27
240851132191 hypothetical membrane protein [Bartonella grahamii as4a 1 1e-24
292486979183 hypothetical protein EAMY_0491 [Erwinia amylovora CFBP1 1 2e-24
49476082193 hypothetical protein BH14180 [Bartonella henselae str. 1 2e-24
310766387183 hypothetical protein EJP617_16560 [Erwinia sp. Ejp617] 1 3e-24
>gi|284007427|emb|CBA72860.1| conserved hypothetical protein [Arsenophonus nasoniae] Length = 151 Back     alignment and organism information
 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (88%)

Query: 1   MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTW 60
           MIGIGFLFNLI GI QRHYSI+I  +ITTC+ ATRQVLIHILPGD GY   VFG+HLYTW
Sbjct: 53  MIGIGFLFNLILGINQRHYSIIIFSSITTCMTATRQVLIHILPGDPGYYSTVFGLHLYTW 112

Query: 61  SLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYL 97
           SL+FSL IILFISVLMLF+TAEI+VAKSP REIAIYL
Sbjct: 113 SLLFSLAIILFISVLMLFNTAEIQVAKSPAREIAIYL 149


Species: Arsenophonus nasoniae
Genus: Arsenophonus
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|37524258|ref|NP_927602.1| hypothetical protein plu0239 [Photorhabdus luminescens subsp. laumondii TTO1] Length = 189 Back     alignment and organism information
>gi|253987664|ref|YP_003039020.1| hypothetical protein PAU_00181 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] Length = 189 Back     alignment and organism information
>gi|300724708|ref|YP_003714033.1| hypothetical protein XNC1_3917 [Xenorhabdus nematophila ATCC 19061] Length = 188 Back     alignment and organism information
>gi|290476875|ref|YP_003469786.1| hypothetical protein XBJ1_3906 [Xenorhabdus bovienii SS-2004] Length = 184 Back     alignment and organism information
>gi|238919044|ref|YP_002932558.1| hypothetical protein NT01EI_1112 [Edwardsiella ictaluri 93-146] Length = 189 Back     alignment and organism information
>gi|240851132|ref|YP_002972534.1| hypothetical membrane protein [Bartonella grahamii as4aup] Length = 191 Back     alignment and organism information
>gi|292486979|ref|YP_003529849.1| hypothetical protein EAMY_0491 [Erwinia amylovora CFBP1430] Length = 183 Back     alignment and organism information
>gi|49476082|ref|YP_034123.1| hypothetical protein BH14180 [Bartonella henselae str. Houston-1] Length = 193 Back     alignment and organism information
>gi|310766387|gb|ADP11337.1| hypothetical protein EJP617_16560 [Erwinia sp. Ejp617] Length = 183 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 hypothetical protein CLIBASIA_01115 [Candidatus Liberib
COG1495170 DsbB Disulfide bond formation protein DsbB [Posttransla 97.27
PRK04388172 disulfide bond formation protein B; Provisional 96.63
pfam02600159 DsbB Disulfide bond formation protein DsbB. This family 96.31
PRK01749175 disulfide bond formation protein B; Provisional 95.39
PRK02110169 disulfide bond formation protein B; Provisional 95.34
>COG1495 DsbB Disulfide bond formation protein DsbB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04388 disulfide bond formation protein B; Provisional Back     alignment and domain information
>pfam02600 DsbB Disulfide bond formation protein DsbB Back     alignment and domain information
>PRK01749 disulfide bond formation protein B; Provisional Back     alignment and domain information
>PRK02110 disulfide bond formation protein B; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01115 [Candidatus Liberib
2zuq_A176 Disulfide bond formation protein B; disulfide bond, mem 97.03
>2zuq_A Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* Back     alignment and structure
Probab=97.03  E-value=0.00059  Score=43.83  Aligned_cols=73  Identities=12%  Similarity=0.260  Sum_probs=50.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCH------------------------------HHHHHHHHHHHHHHHH
Q ss_conf             8899999999999999999999860478998545------------------------------6752257999999999
Q gi|254780338|r   17 RHYSIMILGAITTCIIATRQVLIHILPGDLGYSI------------------------------PVFGMHLYTWSLIFSL   66 (129)
Q Consensus        17 ~hyg~~il~A~~G~~~s~RQi~lHi~pg~~GyG~------------------------------~i~GlH~YTWA~i~f~   66 (129)
                      ......++.++.|...|.||+.++-.|.++.-++                              .++|+++.+|+++.|.
T Consensus        72 ~~~~~~~l~~~~g~~~a~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~e~~w~~lGlSma~wnli~~~  151 (176)
T 2zuq_A           72 VAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFI  151 (176)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHSCCSSCCCCCCC-----CCSSTTCSTTTCCCCCCCSCCCCSTTSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCHHHCCCCHHHHHHHHHH
T ss_conf             99999999999999999999999817764434564224444578999988822789884530088726679999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHH
Q ss_conf             999999999960766333113348
Q gi|254780338|r   67 VIILFISVLMLFDTAEIKVAKSPV   90 (129)
Q Consensus        67 ~~i~~~av~l~~~~~~~~~~~~~~   90 (129)
                      + +...++..++.+..++.+++-+
T Consensus       152 ~-l~~~~~~~l~~~~~~~~~r~l~  174 (176)
T 2zuq_A          152 A-YLIVAVLVVISQPFKAKKRDLF  174 (176)
T ss_dssp             H-HHHHHTTTTC------------
T ss_pred             H-HHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9-9999999999986334202333




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01115 [Candidatus Liberib
d2hi7b1149 Disulfide bond formation protein DsbB {Escherichia coli 95.35
>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: DsbB-like
family: DsbB-like
domain: Disulfide bond formation protein DsbB
species: Escherichia coli [TaxId: 562]
Probab=95.35  E-value=0.017  Score=33.23  Aligned_cols=62  Identities=10%  Similarity=0.301  Sum_probs=46.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCC---------------------H--------HHHHHHHHHHHHH
Q ss_conf             867889999999999999999999986047899-854---------------------5--------6752257999999
Q gi|254780338|r   14 IKQRHYSIMILGAITTCIIATRQVLIHILPGDL-GYS---------------------I--------PVFGMHLYTWSLI   63 (129)
Q Consensus        14 ~r~~hyg~~il~A~~G~~~s~RQi~lHi~pg~~-GyG---------------------~--------~i~GlH~YTWA~i   63 (129)
                      .|.......++.++.|...|.||+.++..|.+. +-+                     +        .+||+++-+|.++
T Consensus        56 ~~~~~~~~~~l~~~~G~~~a~~h~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~e~~w~~lGlSma~wn~i  135 (149)
T d2hi7b1          56 LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDSAERQWDFLGLEMPQWLLG  135 (149)
T ss_dssp             CTHHHHHHTTHHHHHHHHHHHHHHHHTTSCCSSCCCCCCCCCTTSCGGGGSSTTGGGC---------------CHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHCCCCHHHHHHH
T ss_conf             99999999999999999999999998851356765564111002287999999973789876543625436179999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254780338|r   64 FSLVIILFISVL   75 (129)
Q Consensus        64 ~f~~~i~~~av~   75 (129)
                      .|....+.....
T Consensus       136 ~~~~~~~~~~~~  147 (149)
T d2hi7b1         136 IFIAYLIVAVLV  147 (149)
T ss_dssp             HHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01115 [Candidatus Liberib
2zuq_A_176 Disulfide bond formation protein B; disulfide bond 98.39
>2zuq_A (A:) Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* Back     alignment and structure
Probab=98.39  E-value=1.1e-08  Score=74.44  Aligned_cols=115  Identities=5%  Similarity=-0.047  Sum_probs=84.4

Q ss_pred             HHHHHHHHH---HCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             379999999---50886788999999999999999999998604789985456752257999999999999999999960
Q gi|254780338|r    2 IGIGFLFNL---ISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSLVIILFISVLMLF   78 (129)
Q Consensus         2 vg~g~llNl---r~G~r~~hyg~~il~A~~G~~~s~RQi~lHi~pg~~GyG~~i~GlH~YTWA~i~f~~~i~~~av~l~~   78 (129)
                      ++++.++++   |++.|..++++.++.++.|..+|.||+.+|..|+++..+++..+.|.++|....+-......+..-..
T Consensus        54 ~~~~~ll~~~~~~~~~~~~~~~l~~~~a~~G~~~a~~h~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~  133 (176)
T 2zuq_A           54 VLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAER  133 (176)
T ss_dssp             HHHHHHHHHSSCCSSTHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCSSCCCCCCC-----CCSSTTCSTTTCCCCCCCSC
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
T ss_conf             99999999981210389999999999999999999999999832355666762113433277999988830689885544


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             76633311334899999999999999999999941876
Q gi|254780338|r   79 DTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLT  116 (129)
Q Consensus        79 ~~~~~~~~~~~~~~~a~~l~~~vi~~N~vstflecG~~  116 (129)
                      +.+-........+++.+.++.++.+.|..+.+.+||+-
T Consensus       134 ~~~~lGlsm~~ws~i~f~~~~~~~~~~~~~~~~~~~~~  171 (176)
T 2zuq_A          134 QWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKR  171 (176)
T ss_dssp             CCCSTTSCHHHHHHHHHHHHHHHHTTTTC---------
T ss_pred             CHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             53644557999999999999999999999987533201