peg_237

peg_237

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(234338, 234490)Protein Length:50aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYhatnninlsf
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYilllilfiitillfKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINL*F
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooo
ooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
SSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF
MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target50
28400742650 hypothetical protein ARN_14730 [Arsenophonus nasoniae] 1 2e-11
30072470752 putative inner membrane protein [Xenorhabdus nematophil 1 2e-07
23891904552 hypothetical protein NT01EI_1113 [Edwardsiella ictaluri 1 2e-06
29047687452 hypothetical protein XBJ1_3905 [Xenorhabdus bovienii SS 1 3e-06
22458364050 hypothetical protein SPC_1859 [Salmonella enterica subs 1 3e-05
1676074952 hypothetical protein STY2001 [Salmonella enterica subsp 1 4e-05
16386898950 hypothetical protein Btr_2049 [Bartonella tribocorum CI 1 4e-05
24085113350 hypothetical membrane protein [Bartonella grahamii as4a 1 6e-05
4947608350 hypothetical protein BH14190 [Bartonella henselae str. 1 1e-04
>gi|284007426|emb|CBA72859.1| hypothetical protein ARN_14730 [Arsenophonus nasoniae] Length = 50 Back     alignment and organism information
 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%)

Query: 1  MFLPFLIAFLVSISLILKQRKISYILLLILFIITILLFKYHATNNINLSF 50
          MFLPFLIAFLV+ISLI KQRK+SY+LLL+LFIITILLFKYHAT+NINLSF
Sbjct: 1  MFLPFLIAFLVTISLIFKQRKLSYLLLLMLFIITILLFKYHATDNINLSF 50


Species: Arsenophonus nasoniae
Genus: Arsenophonus
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|300724707|ref|YP_003714032.1| putative inner membrane protein [Xenorhabdus nematophila ATCC 19061] Length = 52 Back     alignment and organism information
>gi|238919045|ref|YP_002932559.1| hypothetical protein NT01EI_1113 [Edwardsiella ictaluri 93-146] Length = 52 Back     alignment and organism information
>gi|290476874|ref|YP_003469785.1| hypothetical protein XBJ1_3905 [Xenorhabdus bovienii SS-2004] Length = 52 Back     alignment and organism information
>gi|224583640|ref|YP_002637438.1| hypothetical protein SPC_1859 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] Length = 50 Back     alignment and organism information
>gi|16760749|ref|NP_456366.1| hypothetical protein STY2001 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] Length = 52 Back     alignment and organism information
>gi|163868989|ref|YP_001610219.1| hypothetical protein Btr_2049 [Bartonella tribocorum CIP 105476] Length = 50 Back     alignment and organism information
>gi|240851133|ref|YP_002972535.1| hypothetical membrane protein [Bartonella grahamii as4aup] Length = 50 Back     alignment and organism information
>gi|49476083|ref|YP_034124.1| hypothetical protein BH14190 [Bartonella henselae str. Houston-1] Length = 50 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00