254780339

254780339

hypothetical protein CLIBASIA_01120

GeneID in NCBI database:8209324Locus tag:CLIBASIA_01120
Protein GI in NCBI database:254780339Protein Accession:YP_003064752.1
Gene range:+(234860, 235126)Protein Length:88aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------
MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC
ccccccccHHHHHHccccEEEEEEEEcccccEEEEEEcccccHHHHHHHHHcccHHHHccccEEEEEEccccccccEEEEEEcccccc
cccccccccHHHHHHcccEEEEEEEEccccccHHHHHHHHHcHHHHHHHHHcccHHHHHHHcHEEEEEcccHHHHHHHHHHHcccccc
mikstkdsnlkeAITNNRVEIANIRadmsgtsmKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNvptanslqNWFLLSTNLSEC
mikstkdsnlkeaitnnrveianIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC
MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC
*************ITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLS**
********NLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC
******DSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target88 hypothetical protein CLIBASIA_01120 [Candidatus Liberib
254781198117 guanylate kinase [Candidatus Liberibacter asiaticu 3e-04
>gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Back     alignment
 Score = 34.7 bits (78), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 8   SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54
           + L EAI +NR +IAN+R +++   ++   +++E+  + WKI  T IG S
Sbjct: 51  TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00