254780340

254780340

proline/glycine betaine ABC transporter, ATP-binding protein

GeneID in NCBI database:8209325Locus tag:CLIBASIA_01125
Protein GI in NCBI database:254780340Protein Accession:YP_003064753.1
Gene range:-(236356, 237402)Protein Length:348aa
Gene description:proline/glycine betaine ABC transporter, ATP-binding protein
COG prediction:[E] ABC-type proline/glycine betaine transport system, ATPase component
KEGG prediction:proline/glycine betaine ABC transporter, ATP-binding protein; K02000 glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
SEED prediction:L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:Choline and Betaine Uptake and Betaine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS
ccccEEEEEccEEEcccccccHHcccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEEccEEcccccccccHHHHHHHHHccEEEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHcccccccccccccEEcccccccccEEcccccccHHHHHHHHHcccccEEEEEcccEEEEEEHHHHHHHHHHHHccc
ccccEEEEEccEEEccccHHHHHHHccccEEHHcEEEEEcEEEEEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEccccccHHcHHHcccHccccEEEccHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcHHHHHHcccEHHHHHHccccEEEEEEEEccEEEEccEcccccccccccccccccEEEEEccccccEEEEcccccEEEEEEHHHHHHccccccccc
mndcavkfrdvdivfgetsnkirkrsrysikkhdkvsEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSInglapvvrgevlvdtdkgfvnpyaadANVLRKLRMHTVSMVFQQFALLPWRTVARNVELglefldipdverkSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFatgapillmdepfssldpLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNriaimeggriiqcgtpqeiilhpancyVSEFIQKLNPITALVAADVMRvcsiddesnivhkisrqmpLIDIIDMVADNlgkigvveddRIVGIITAIDIVRGlsccrrfs
mndcavkfrdvdivfgetsnkirkrsrysikkhdkvseyGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEvlvdtdkgfvnPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLefldipdverKSRVAehleivnltkwadcKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIdivrglsccrrfs
MNDCAVKFRDVDIVFGETSNkirkrsrysikkHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS
**DCAVKFRDVDIVFGETSNKI************KVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVR**SC*****
MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS
*NDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGL*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS
MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS
MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target348 proline/glycine betaine ABC transporter, ATP-binding pr
254780596 438 ABC transporter nucleotide binding/ATPase protein 3e-34
254780559234 thiamine transporter ATP-binding subunit [Candidat 5e-23
254780139257 putative ATP-binding component of ABC transporter 2e-22
254780704254 ABC transporter, nucleotide binding/ATPase protein 1e-21
254780173257 ABC transporter related protein [Candidatus Liberi 2e-21
254780744262 ABC transporter nucleotide binding/ATPase protein 3e-20
254780538280 ABC transporter, nucleotide binding/ATPase protein 1e-13
254780871227 lipoprotein-releasing system ATP-binding protein l 2e-12
254780917596 ABC transporter, nucleotide binding/ATPase protein 1e-08
254780718240 putative high-affinity zinc uptake system ATP-bind 2e-08
254780576597 ABC transporter related protein [Candidatus Liberi 3e-08
254780193528 lipid A ABC exporter family, fused ATPase and inne 5e-08
254780273539 putative ABC transporter ATP-binding protein [Cand 9e-07
254780273 539 putative ABC transporter ATP-binding protein [Cand 0.002
254780184 959 excinuclease ABC subunit A [Candidatus Liberibacte 6e-06
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 0.005
254781123610 putative ABC transporter, ATP-binding protein [Can 5e-05
254781123 610 putative ABC transporter, ATP-binding protein [Can 5e-05
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 1e-04
254781060249 ABC transporter, nucleotide binding/ATPase protein 0.014
254780826509 phosphoenolpyruvate carboxykinase [Candidatus Libe 0.046
>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score =  137 bits (345), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 129/243 (53%), Gaps = 26/243 (10%)

Query: 47  KANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLR 106
           K N  V  GEI+ L+G SG+GKSTLLR I GL     G+VL    K    P         
Sbjct: 35  KVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKKIKDPP--------- 85

Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCK 166
                 +S+VFQ FAL PW TV  NVELGL+   I   ER+ R    ++++ L  +    
Sbjct: 86  ----KDISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLIGLDGFESAH 141

Query: 167 INMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ---RKLKKTI 223
              +SGGM QRVGFARAF     +LLMDEPFS+LD L    L+ +L+ L    R   +++
Sbjct: 142 TTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIESM 201

Query: 224 VFVSHDINEAFRLGNRIAIMEG--GRIIQCGTPQEIIL---HPANCYVSEFIQKLNPITA 278
           + V+H+I EA  + +R+ +     GRI      +E+++   HP N    EF Q +  I A
Sbjct: 202 LMVTHNIEEAVLMCDRVLVFSSNPGRI-----AEEVLISIPHPRNRLSPEFRQIVEKIYA 256

Query: 279 LVA 281
           L+ 
Sbjct: 257 LMT 259

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score =  100 bits (248), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 113/213 (53%), Gaps = 10/213 (4%)

Query: 46  IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVL 105
           ++ + +V K E +V++G SGAGKSTLL  + G     RG + ++        +   +   
Sbjct: 16  MQFDFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQN-----HTRSSPSK 70

Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165
           R L     S++FQ+  L    TV +N+ LG+      D  + ++V + LE V L  + + 
Sbjct: 71  RPL-----SILFQENNLFSHLTVWQNIALGIAPNLRLDHYQHAQVKQMLEKVFLEDFFNR 125

Query: 166 KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225
             + +SGG +QRV  AR      PILL+DEPF+  DP +R  +   L  +  + + T++ 
Sbjct: 126 FPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLM 185

Query: 226 VSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258
           +SH++ ++ ++  R  ++ GG+I+  G P  ++
Sbjct: 186 ISHNLEDSMQIATRFIVIAGGQIVYDGDPDRLM 218

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 97.8 bits (242), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 112/215 (52%), Gaps = 17/215 (7%)

Query: 51  EVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV-----DTDKGFVNPYAADANVL 105
           ++ +GEIL ++G SG GKS L+R I GL P V GEV V     +  KG  N +A  A + 
Sbjct: 35  DILRGEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQN-FAFSAKL- 92

Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKSRVAEHLEIVNLT-KWA 163
                    ++FQ  AL    TV  N+ + + E L++P    +  V   + IV L  + A
Sbjct: 93  --------GVLFQHGALFSSMTVQENISMPIKEHLNLPADLIEHIVHTKIAIVGLPPETA 144

Query: 164 DCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223
           +     LSGGM +RV  ARA A    +L +DEP S LDP+        L+ L+  L  ++
Sbjct: 145 NLMPFQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSV 204

Query: 224 VFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258
             ++HD+N      NR+A+++   I++ GT  +I+
Sbjct: 205 YMITHDLNNLISTCNRVAVIQKKGIMKEGTISDIV 239

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 95.9 bits (237), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 122/245 (49%), Gaps = 24/245 (9%)

Query: 39  YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAP-----VVRGEVLVDTDKG 93
           YG   A+   NL++ +  +  L+G SG GKST LR +N +       V  GE+++D    
Sbjct: 16  YGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGK-- 73

Query: 94  FVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPD--------VE 145
             N Y +  +V+R LR   V MVFQ+    P +++  NV  G     + +        VE
Sbjct: 74  --NIYQSSVDVVR-LRAR-VGMVFQRPNPFP-KSIYDNVAYGPRIHGLGNNKADIDQIVE 128

Query: 146 RKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIR 205
              + A     V    + D   ++LSGG +QRV  ARA A    ++LMDEP S+LDP+  
Sbjct: 129 MSLKKASLFNEVKDRLFHDA--SLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIAT 186

Query: 206 MRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCY 265
             +++ +  L+  L  TIV V+H + +A R+  R A+   G +++     ++   P++  
Sbjct: 187 ASVEELIHELRESL--TIVIVTHSMQQAARVSQRAAMFHMGHLVEEDDTDKMFTAPSDQR 244

Query: 266 VSEFI 270
             ++I
Sbjct: 245 TQDYI 249

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 95.1 bits (235), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 124/236 (52%), Gaps = 8/236 (3%)

Query: 39  YGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY 98
           YG   A+   NL V +GE +++ G SG+GKSTL+R IN +     GE++++   G   P 
Sbjct: 27  YGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIIN---GI--PL 81

Query: 99  AADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFL-DIPDVERKSRVAEHLEIV 157
             D   + ++R   V MVFQ F L    +V  N  LG  ++  +P  + +     +L  V
Sbjct: 82  NDDIRNIHEVR-RDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKV 140

Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217
            +   +    ++LSGG  QR   AR+      I+L DEP S+LDP +   + D ++ L  
Sbjct: 141 KIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAE 200

Query: 218 KLKKTIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKL 273
           +   T+V V+H++  A ++ +R+  M+ G+I++  +P+E   +P +     F+ ++
Sbjct: 201 E-GMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQI 255

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 90.9 bits (224), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 112/224 (50%), Gaps = 14/224 (6%)

Query: 38  EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNP 97
           +Y  V  V   +L VK GEI+ L+G +GAGK+T    + GL     G + +D +     P
Sbjct: 34  KYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMP 93

Query: 98  YAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIV 157
                 + R+ R+  +S + Q+ ++    TV  N+   LE  +    +R  ++   L+  
Sbjct: 94  ------MYRRARL-GISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEF 146

Query: 158 NLTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQR 217
           N+TKW      +LSGG ++R+  AR+  +    +L+DEPF+ +DP+       ++  L R
Sbjct: 147 NITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA----ISDIHVLIR 202

Query: 218 KLKK---TIVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258
            L      I+   H+++E   L +R  I+  G ++  GT QEII
Sbjct: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 96/196 (48%), Gaps = 32/196 (16%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108
           NL + +  I  L+GL+GAGKSTL ++I GL P+ +G + +  ++   N   AD  +    
Sbjct: 32  NLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI-FNQTVENALKADL-IAYIP 89

Query: 109 RMHTVSMVFQ----------QFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVN 158
           +  ++   F           ++  + WR VA N +  +             V E LE V 
Sbjct: 90  QTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI-------------VTEALENVG 136

Query: 159 LTKWADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218
           ++     +I  LS G ++RV  ARA A  + +++MDEPF+++D     + + E++ L + 
Sbjct: 137 MSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID----FKTEREMIFLLKS 192

Query: 219 LKKT---IVFVSHDIN 231
           L      I+  +H+IN
Sbjct: 193 LLNEDIMILVSTHNIN 208

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 96/198 (48%), Gaps = 6/198 (3%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVV-RGEVLVDTDKGFVNPYAADANVLRK 107
           +L +KKGEI+ L+  SG GKST+L  I GL  V  +G V++       N  + D      
Sbjct: 30  HLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQGNVIIANQ--LCNKLSDDKKSF-- 84

Query: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167
           LR   +  V+Q+  LL   +V  N+        I       R  + L  ++++++A+ + 
Sbjct: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144

Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227
           + +SGG +QRV   RA A    I+L DEP  +LD     ++   L  L  +     +  +
Sbjct: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAT 204

Query: 228 HDINEAFRLGNRIAIMEG 245
           H+ + A ++  +I I +G
Sbjct: 205 HNHDLASQMDRQITIRDG 222

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 26/238 (10%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108
           NL  K G++  L+G SG+GKST++  +  +     G + +D     +N      + LR+ 
Sbjct: 373 NLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDG----INIRDITFSSLRE- 427

Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPD-VERKSRVAEHLEIVNLTKWADCKI 167
               +S V Q   L    TV  N+ +G       + +E       H  I++L +  D  +
Sbjct: 428 ---RISYVGQDVFLFS-NTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYV 483

Query: 168 ----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK-KT 222
               + LSGG KQR+  ARA      IL++DE  S+LD      ++    AL R ++ +T
Sbjct: 484 GENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQ---ALSRLMQGRT 540

Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPAN------CYVSEFIQKLN 274
            + ++H I+      + I  +E G++ + G  Q+ +L   +       Y S+ ++ L+
Sbjct: 541 TIVIAHRISTIIE-ADHIIFIEDGKVSESG-DQKYLLQQKDGSLYKKMYASQLLENLS 596

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 90/210 (42%), Gaps = 27/210 (12%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108
           N  +K  EI+ L+G +G+GKST+ + I G+     G V                   ++ 
Sbjct: 30  NFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSV-------------------KRH 70

Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGL-EFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167
               V  V Q+       T+   + L L  F+ +     +  V + L+ VNL    +  I
Sbjct: 71  PQLIVGYVPQKV------TIENTLPLSLMRFMTLSMPSSRDDVLQILDRVNLIGKYNRNI 124

Query: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227
             LSGG  QR   A+A      +L++DEP   +D    + L + + ++++     I+ +S
Sbjct: 125 KDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCGILLIS 184

Query: 228 HDINEAFRLGNRIAIMEGGRIIQCGTPQEI 257
           H+++      + +  +   RI   G PQ I
Sbjct: 185 HNLHMVMASTDTVICLN-NRICYQGPPQTI 213

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229
           LSGG KQRV  ARA     PI++ DE  SSLD +    +Q  L  L +   +T + ++H 
Sbjct: 494 LSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK--NRTTLVIAHR 551

Query: 230 INEAFRLGNRIAIMEGGRIIQCGTPQEII 258
           ++      N I + + G +++ G+ + +I
Sbjct: 552 LSTITDADN-IIVFDQGTVVESGSHENLI 579

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 50.1 bits (118), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 101/216 (46%), Gaps = 19/216 (8%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108
           N  V+ GE + L+G SGAGK+++       + ++R     D   G V     D  +L   
Sbjct: 310 NFTVQPGETIALVGDSGAGKTSIF------SLILR---FYDPCSGSVEIEGIDLRLLSLE 360

Query: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL------TKW 162
            +        Q  ++   +V  N+ +G       +++  + +A+  E +        T  
Sbjct: 361 EIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTIL 420

Query: 163 ADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222
            D  ++ LS G  QR+  ARA    +PILL+DE  S+LD     ++  ++L  QR+  +T
Sbjct: 421 GDGAVH-LSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIW-KVLREQRR-GRT 477

Query: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258
            +F SH ++ A +  + + ++    I++ G  +E++
Sbjct: 478 TIFASHRLS-AIQDADMVFVLHDQVIVEKGVHEELL 512

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 46.2 bits (108), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 83/202 (41%), Gaps = 33/202 (16%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108
           + ++  G I+ ++G +GAGK+TL R + G      G + V                    
Sbjct: 337 SFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVG------------------- 377

Query: 109 RMHTVSMVF---QQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165
              TV + +    + +L   +TV  ++  G + + +   E  SR   +    N  K  D 
Sbjct: 378 --ETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRA--YCSAFNF-KGGDQ 432

Query: 166 --KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223
             +I  LSGG + RV  A+   +G  ++L+DEP + LD      L+D L           
Sbjct: 433 QQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDAL----ENFAGCA 488

Query: 224 VFVSHDINEAFRLGNRIAIMEG 245
           V +SHD     RL   I   EG
Sbjct: 489 VIISHDRMFLDRLATHILAFEG 510

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 36/191 (18%)

Query: 60  LMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVN---PYAADANVLRKLRMHTVSMV 116
           ++G +GAGKST+LR + G+     GE  + T  GF     P     ++ + ++ + +  V
Sbjct: 37  ILGPNGAGKSTILRIMAGIDKEYNGEAWLAT--GFTVGYLPQEPQLDLSKTVKENIIEGV 94

Query: 117 FQQFALLPWRTVARNVELGLEFLD-----------------IPDVERKSRVAEHLEIVNL 159
             + A+L      R  EL + + +                 + D+E + +VA    I +L
Sbjct: 95  AHKQAILD-----RYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVA----IESL 145

Query: 160 TKWAD-CKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218
              AD   I  LSGG K+RV   +   +   +LL+DEP + LD      ++  L    R+
Sbjct: 146 HCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYL----RE 201

Query: 219 LKKTIVFVSHD 229
               ++ V+HD
Sbjct: 202 YSGAVLMVTHD 212

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 43.1 bits (100), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 168 NMLSGGMKQRVGFARAFATG--APILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVF 225
           NMLS G  QR+  A    +     + ++DEP   L      +L + L  L R    T++ 
Sbjct: 502 NMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHL-RDTGNTVIV 560

Query: 226 VSHDINEAFRLGNRI------AIMEGGRIIQCGTPQEIILHPAN 263
           V HD  E     + I      A + GG+I+  G+P +II HP +
Sbjct: 561 VEHD-EETMLAADHIVDIGPEAGINGGKIVAEGSPSQIIAHPTS 603

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 168 NMLSGGMKQRVGFARAF---ATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIV 224
           N LSGG  QRV  A+     ATG  + ++DEP + L      +L + L  L  +   +I+
Sbjct: 844 NTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR-GNSII 902

Query: 225 FVSHDINEAFRLGNRI------AIMEGGRIIQCGTPQEIILHPANCYVSEFIQKL 273
            + H++ E  +  + I          GG II  G P+ I   P + Y  +F++ +
Sbjct: 903 VIEHNL-EVIKTADWILDFGPEGGDGGGEIIASGPPEAIAKEPLS-YTGKFLKSI 955

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 40.4 bits (93), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 83/216 (38%), Gaps = 61/216 (28%)

Query: 34  DKVS-EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSING--------------- 77
           DK++ +Y     V   +L +  GE + ++G +GAGK+TLL+ + G               
Sbjct: 288 DKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNL 347

Query: 78  -LAPVVRGEVLVDTDKG---FVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVE 133
            +A + +    +D DK    ++   + D+ ++R    H    +                 
Sbjct: 348 KIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYI----------------- 390

Query: 134 LGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLM 193
              +FL  PD                   A   +  LSGG K R   AR  A     L+M
Sbjct: 391 --KDFLFHPDQ------------------AHSLMKHLSGGEKMRAIVARVLAQPFNFLIM 430

Query: 194 DEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229
           DEP + LD        D L     +L+ TI+ VSHD
Sbjct: 431 DEPTNDLD----FETLDFLERTITQLQGTILIVSHD 462

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 40.0 bits (92), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 45/188 (23%)

Query: 50  LEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK--GFV--NP----YAAD 101
           L +K  E + L+G +G+GKSTLL+   G+     G V + +    G++  NP    ++  
Sbjct: 26  LSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTI 85

Query: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161
           +  +      T+   +  ++LL                      +K  + E   I NL  
Sbjct: 86  SQYIDDTIKDTIEAPYSPYSLL----------------------KKFNLREQDRIENL-- 121

Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221
                    S G  + V   +   +   IL++DEP + LD      ++ ELL    K+  
Sbjct: 122 ---------SVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELL----KINS 168

Query: 222 TIVFVSHD 229
            ++FVSHD
Sbjct: 169 ALIFVSHD 176

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 39.3 bits (90), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 21/188 (11%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV---DTDKGFVNPYAADANVL 105
           +  + +G   ++ G SG GKS  L  + GL  + +G +        + F+  ++A    L
Sbjct: 352 SFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYL 411

Query: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR-VAEHLEIVNL---TK 161
                       Q  +L P  ++  N+ L  +   +   ++ ++ V  H +I++L    +
Sbjct: 412 S-----------QHCSLFPI-SITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQ 459

Query: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221
              C  + +   + Q++  +R  A    ILLMDEP   LD   +      LL   ++ KK
Sbjct: 460 TTYCS-DEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFY-TLLKQFKENKK 517

Query: 222 TIVFVSHD 229
           TIV +SHD
Sbjct: 518 TIVIISHD 525

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 32.0 bits (71), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 101/227 (44%), Gaps = 42/227 (18%)

Query: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLA--PVVRGEVLVDTDKGFVNPYAADANVLR 106
           NL+V+  E++ +MG +G+GKSTL   ++G     +  G++L      +      D +++ 
Sbjct: 23  NLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL------YKGESILDWSIVE 76

Query: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIP-DVERKSRVAEHLEIVNLTK---- 161
           +     + + FQ    +P   +       ++FL I  + +RK+R  + L I + T+    
Sbjct: 77  RAS-KGIFLAFQYPVEIPGIIM-------MQFLKIALNEQRKARNEKELLIPDFTRKVRK 128

Query: 162 -WADCKINM----------LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQD 210
             A+  INM           SGG K+     +       + ++DE  S LD +  +++  
Sbjct: 129 ITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-IDALKIAA 187

Query: 211 ELLALQRKLKKTIVFVSHDINEAFRLGNRIA-----IMEGGRIIQCG 252
           + +   R   ++ + ++H      RL N I      ++  G+II+ G
Sbjct: 188 QGVNALRSQDRSFLIITH----YQRLLNYIKPDTIHVLHNGKIIKTG 230

>gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Back     alignment
 Score = 30.4 bits (67), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 24  KRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSIN 76
           K+S ++   H    E G++      N++ +K ++ +  GLSG GK+TL  S++
Sbjct: 188 KKSVFTYLNH-IFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVD 239

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target348 proline/glycine betaine ABC transporter, ATP-binding pr
315122236353 proline/glycine betaine ABC transporter, ATP-binding pr 1 1e-175
86358688350 proline/glycine betaine ABC transporter, ATP-binding pr 1 1e-117
209550404350 choline ABC transporter ATP-binding protein [Rhizobium 1 1e-117
190892829350 proline/glycine betaine ABC transporter ATP-binding pro 1 1e-116
327189487350 proline/glycine betaine ABC transporter, ATP-binding pr 1 1e-116
227822906349 putative glycine betaine/L-proline ABC transporter, ATP 1 1e-114
15966154349 putative glycine betaine transport ATP-binding ABC tran 1 1e-114
116253277350 ATP-binding component of ABC transporter [Rhizobium leg 1 1e-114
218661667339 choline ABC transporter, ATP-binding protein [Rhizobium 1 1e-114
150397507349 ABC transporter-like protein [Sinorhizobium medicae WSM 1 1e-113
>gi|315122236|ref|YP_004062725.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 353 Back     alignment and organism information
 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 299/348 (85%), Positives = 326/348 (93%)

Query: 1   MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAVIKANLEVKKGEILVL 60
           MNDCAVKFRDVDIVFGE+S KIRKR + SIKK D+ S Y +VSAV KANLEVKKGEILVL
Sbjct: 1   MNDCAVKFRDVDIVFGESSKKIRKRFKCSIKKEDEDSTYRIVSAVTKANLEVKKGEILVL 60

Query: 61  MGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKLRMHTVSMVFQQF 120
           MGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPY+ DA+VLRKLRMHTVSMVFQQF
Sbjct: 61  MGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYSTDASVLRKLRMHTVSMVFQQF 120

Query: 121 ALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGF 180
           ALLPWRTVARNVELGLEFLDI D+ERKSRVAE LEIVNLTKWADCKINMLSGGMKQRVGF
Sbjct: 121 ALLPWRTVARNVELGLEFLDISDIERKSRVAEQLEIVNLTKWADCKINMLSGGMKQRVGF 180

Query: 181 ARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLGNRI 240
           ARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQ++LKKTIVFVSHDINEAFRLGNRI
Sbjct: 181 ARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQKQLKKTIVFVSHDINEAFRLGNRI 240

Query: 241 AIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVAADVMRVCSIDDESNIVHKI 300
           AIMEGGRIIQCGTPQEIILHPAN YVSEF+QKLNPIT LVA+D+MR  S  DES+IV+K+
Sbjct: 241 AIMEGGRIIQCGTPQEIILHPANGYVSEFVQKLNPITTLVASDIMRSFSEGDESDIVNKV 300

Query: 301 SRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRGLSCCRRFS 348
            +QM L+DIIDMVADN GKIGVV D +I+G+ITA++I++GL+CCR+F+
Sbjct: 301 PKQMSLVDIIDMVADNSGKIGVVADGKIIGVITAMEIIKGLACCRKFT 348


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86358688|ref|YP_470580.1| proline/glycine betaine ABC transporter, ATP-binding protein [Rhizobium etli CFN 42] Length = 350 Back     alignment and organism information
>gi|209550404|ref|YP_002282321.1| choline ABC transporter ATP-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 350 Back     alignment and organism information
>gi|190892829|ref|YP_001979371.1| proline/glycine betaine ABC transporter ATP-binding protein [Rhizobium etli CIAT 652] Length = 350 Back     alignment and organism information
>gi|327189487|gb|EGE56643.1| proline/glycine betaine ABC transporter, ATP-binding protein [Rhizobium etli CNPAF512] Length = 350 Back     alignment and organism information
>gi|227822906|ref|YP_002826878.1| putative glycine betaine/L-proline ABC transporter, ATP-binding protein [Sinorhizobium fredii NGR234] Length = 349 Back     alignment and organism information
>gi|15966154|ref|NP_386507.1| putative glycine betaine transport ATP-binding ABC transporter protein [Sinorhizobium meliloti 1021] Length = 349 Back     alignment and organism information
>gi|116253277|ref|YP_769115.1| ATP-binding component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 350 Back     alignment and organism information
>gi|218661667|ref|ZP_03517597.1| choline ABC transporter, ATP-binding protein [Rhizobium etli IE4771] Length = 339 Back     alignment and organism information
>gi|150397507|ref|YP_001327974.1| ABC transporter-like protein [Sinorhizobium medicae WSM419] Length = 349 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target348 proline/glycine betaine ABC transporter, ATP-binding pr
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 1e-123
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 1e-59
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 3e-44
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine transpo 2e-97
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 3e-83
PRK10070400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 4e-59
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 2e-51
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 3e-49
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 7e-49
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 2e-42
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 2e-42
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 9e-42
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 1e-40
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 2e-37
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 9e-37
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 8e-35
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 2e-34
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 2e-30
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 1e-29
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 2e-28
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 5e-28
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 2e-25
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 7e-25
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 1e-24
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 7e-24
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 2e-23
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 3e-20
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 3e-20
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 2e-19
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 4e-19
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 4e-19
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-18
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 5e-18
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 8e-18
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 9e-18
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 2e-17
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 5e-17
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 5e-17
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-16
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-16
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 5e-16
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 3e-15
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 3e-14
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 6e-12
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 8e-11
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 9e-11
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 3e-10
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 3e-10
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 5e-10
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 4e-08
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 2e-07
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 4e-06
cd03288257 cd03288, ABCC_SUR2, The SUR domain 2 4e-05
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 4e-67
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 1e-57
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine transport 4e-56
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 2e-48
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 4e-48
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transporter 5e-48
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 2e-47
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 1e-45
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 5e-44
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding subu 8e-44
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 2e-43
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 5e-43
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 4e-41
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 3e-40
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 1e-39
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 4e-39
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 6e-39
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 1e-38
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 1e-38
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 4e-38
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 4e-38
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 4e-38
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 6e-38
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 4e-37
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 1e-36
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 3e-36
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 5e-36
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 5e-36
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 2e-34
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 9e-34
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 4e-32
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 1e-31
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 1e-31
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 2e-31
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 6e-31
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 2e-29
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 3e-29
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 5e-29
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 5e-29
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 7e-29
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 6e-28
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 7e-28
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 7e-28
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 5e-27
COG4148352 COG4148, ModC, ABC-type molybdate transport system, ATP 5e-27
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 9e-27
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 1e-26
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 2e-26
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 3e-26
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 5e-26
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 5e-26
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 7e-26
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 8e-26
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 9e-26
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 1e-25
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 2e-25
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 2e-25
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 6e-25
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 7e-25
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 8e-25
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 1e-24
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 1e-24
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 3e-24
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 3e-24
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 3e-24
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 3e-24
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 4e-24
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 7e-24
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 9e-24
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 1e-23
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 2e-23
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 2e-23
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 2e-23
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 4e-23
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 4e-23
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 6e-23
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 7e-23
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 8e-23
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 1e-22
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 2e-22
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 2e-22
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 2e-22
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 3e-22
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 3e-22
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 4e-22
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 4e-22
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 4e-22
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 5e-22
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 6e-22
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 6e-22
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 7e-22
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 7e-22
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 9e-22
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-21
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 1e-21
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 1e-21
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding prote 2e-21
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 2e-21
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 3e-21
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 4e-21
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 6e-21
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 6e-21
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 6e-21
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 1e-20
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 2e-20
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 2e-20
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 2e-20
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 3e-20
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 4e-20
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 5e-20
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 6e-20
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 6e-20
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 8e-20
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 1e-19
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 1e-19
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 1e-19
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 1e-19
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 2e-19
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 3e-19
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 3e-19
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 4e-19
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 5e-19
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 9e-19
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 1e-18
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 1e-18
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 2e-18
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 2e-18
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 4e-18
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 5e-18
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 6e-18
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 6e-18
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 8e-18
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 1e-17
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 1e-17
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 1e-17
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 2e-17
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 2e-17
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 2e-17
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 2e-17
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 3e-17
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 3e-17
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 3e-17
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 4e-17
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 6e-17
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 4e-16
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 5e-16
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 5e-16
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 5e-16
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 6e-16
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 1e-15
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 1e-15
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 2e-15
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-15
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 2e-15
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 3e-15
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 3e-15
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 3e-15
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 4e-15
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 4e-15
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 7e-15
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 9e-15
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-14
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 1e-14
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 2e-14
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 2e-14
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 5e-14
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 6e-14
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 7e-14
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 1e-13
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 2e-13
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 3e-13
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 4e-13
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 2e-12
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 2e-12
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 6e-12
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-11
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 5e-11
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 1e-10
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 1e-10
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 2e-10
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 4e-10
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 3e-09
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 9e-09
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 1e-08
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 7e-08
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 8e-08
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 1e-07
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 1e-07
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 1e-07
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 2e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 1e-05
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 2e-05
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport ATP-b 7e-05
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 1e-04
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 1e-04
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 0.003
PLN031301622 PLN03130, PLN03130, ABC transporter C family member; Pr 0.004
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 1e-56
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 6e-56
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 1e-55
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 1e-41
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 6e-39
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 2e-38
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 5e-38
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 9e-37
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 4e-35
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 2e-34
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 8e-33
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 8e-31
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 1e-30
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-30
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 8e-30
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 1e-29
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 2e-29
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 2e-29
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 5e-29
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 1e-28
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 2e-28
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 7e-27
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 3e-26
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 1e-25
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 2e-25
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 2e-25
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 4e-25
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 5e-25
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 1e-24
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 7e-24
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 1e-23
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 2e-23
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 2e-22
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 2e-22
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 5e-22
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 9e-22
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 9e-22
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 2e-21
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 1e-20
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 6e-20
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 1e-19
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 7e-19
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 7e-19
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 8e-19
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 8e-19
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 2e-18
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 2e-18
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 2e-18
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 2e-18
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 3e-18
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 3e-18
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 7e-18
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 2e-17
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 3e-17
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 3e-17
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 4e-17
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 5e-17
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 7e-17
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 1e-16
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 1e-16
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 1e-16
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 2e-16
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 7e-16
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 5e-15
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 5e-15
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 8e-15
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 4e-14
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 2e-13
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 3e-13
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 4e-13
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 6e-13
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 1e-12
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 2e-12
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 2e-12
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 1e-11
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 4e-11
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 2e-10
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 2e-10
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 2e-10
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 4e-10
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 6e-10
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 1e-09
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 1e-09
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 3e-09
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 1e-08
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 1e-08
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 4e-08
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 5e-08
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 5e-08
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 7e-08
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 2e-07
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-07
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 4e-07
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 3e-06
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 1e-05
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 1e-05
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family member; Pr 2e-05
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 3e-05
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 8e-05
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 8e-05
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-04
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 2e-04
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 2e-04
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 4e-04
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 5e-04
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 0.001
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 0.003
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 7e-53
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 8e-22
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 2e-20
pfam00005119 pfam00005, ABC_tran, ABC transporter 7e-20
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 5e-19
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 3e-16
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 2e-15
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 2e-13
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 5e-12
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 1e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 5e-06
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 1e-05
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 1e-05
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 1e-05
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 6e-09
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-08
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 3e-06
TIGR00630 924 TIGR00630, uvra, excinuclease ABC, A subunit 2e-05
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 3e-05
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 9e-05
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 9e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 2e-04
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 3e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 7e-04
smart00382148 smart00382, AAA, ATPases associated with a variety of c 9e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 5e-08
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-05
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 3e-05
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 9e-04
cd01854287 cd01854, YjeQ_engC, YjeQ/EngC 9e-04
pfam03193161 pfam03193, DUF258, Protein of unknown function, DUF258 0.001
COG1162301 COG1162, COG1162, Predicted GTPases [General function p 0.002
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 0.003
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 0.003
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 7e-04
>gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|169949 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183084 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|162130 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|35286 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2 Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183258 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184583 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184124 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184595 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33909 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184589 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184592 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182443 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|184581 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172763 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information