254780341

254780341

proline/glycine betaine ABC transporter, permease protein

GeneID in NCBI database:8209326Locus tag:CLIBASIA_01130
Protein GI in NCBI database:254780341Protein Accession:YP_003064754.1
Gene range:-(237399, 238244)Protein Length:281aa
Gene description:proline/glycine betaine ABC transporter, permease protein
COG prediction:[E] ABC-type proline/glycine betaine transport system, permease component
KEGG prediction:proline/glycine betaine ABC transporter, permease protein; K02001 glycine betaine/proline transport system permease protein
SEED prediction:L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:Choline and Betaine Uptake and Betaine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED5 TM-Helix
HMMTOP7 TM-Helix
MEMSAT7 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHcccccccHHHHHHHHHHcccHHHHEEEEEcHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccc
mspiiqapiplgDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIptsvrltrlgiistppiLKEAAcafgatpfqvfrkvelpfaIPQIVASLTQTIMLSLSMVVVTALVgsnglgvpvlralntvdigrgfESGLCIVILAIILDrlfsipdprdri
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIildrlfsipdprdri
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYlpplvfvcvvsllvlmvKRSITIAVGTAMGLLLIIKQGYWQettetlslvlvstFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
*SP*IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSI*******
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
*SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD*****
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxx
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target281 proline/glycine betaine ABC transporter, permease prote
255764486493 ABC transporter, membrane spanning protein [Candid 0.003
254780705425 phosphate ABC transporter, permease protein PstA [ 0.004
255764497 587 ABC transporter permease [Candidatus Liberibacter 0.006
>gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 67/159 (42%), Gaps = 32/159 (20%)

Query: 105 FISMFIGVPLGVLAAWY------PRFYSIIRLFLDSMQTIPTFVYLIPALVLFG------ 152
           FI+M   VP+G+L A Y       +  ++I+   + +  IPT VY   AL L G      
Sbjct: 265 FIAMLFSVPIGLLIAIYMAEYAPKKLRAVIKPITEMLVGIPTIVYGFFALSLVGPFLRDI 324

Query: 153 ----LGMVPGIVATIVFS--------------IPTSVRLTRLGIISTPPILKEAACAFGA 194
                G++ G   + + +              IP    L+   I S P  L++ +   GA
Sbjct: 325 SIYMNGLITGNYKSFIEAQSVLTAGLVMGIMLIPYVSSLSEDVISSIPRSLRDGSLGLGA 384

Query: 195 TPFQVFRKVELPFAIPQIVAS--LTQTIMLSLSMVVVTA 231
           T  +  + V  P A P I  +  +T +  +  +M+VV A
Sbjct: 385 TRSETMKYVIFPAAFPGIAGAILMTASRTIGETMIVVLA 423

>gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus Liberibacter asiaticus str. psy62] Length = 425 Back     alignment
 Score = 33.5 bits (75), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 16/127 (12%)

Query: 113 PLGVLAAWYPR-------FYSIIRLFLDSMQTIPTFVY-LIPALVLFGLGMVPGIVATI- 163
           PLG+ +A Y         F S ++  ++++ ++P+ VY ++ + VL     +P   A + 
Sbjct: 223 PLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG 282

Query: 164 -----VFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQ-VFRKVELPFAIPQIVASLT 217
                + ++P+ +  T + + + P  ++ AA   GA+  Q VF  V LP A+P I+   T
Sbjct: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHV-LPLAMPAILTGST 341

Query: 218 QTIMLSL 224
            ++  +L
Sbjct: 342 VSLARAL 348

>gi|255764497|ref|YP_003065010.2| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] Length = 587 Back     alignment
 Score = 32.7 bits (73), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 69/152 (45%), Gaps = 10/152 (6%)

Query: 91  QETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVL 150
           Q  + T   +L +  IS+        LAA   R   ++   LD MQ+IP   +L   +V 
Sbjct: 63  QYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILGFLTFTVVY 122

Query: 151 FGLGMVPGIVA----TIVFSIPTSVRLT-----RLGIISTPPILKEAACAFGATPFQVFR 201
           F + + PG V       +F+I TS            + + P  L+E + +F  + +Q F 
Sbjct: 123 F-MNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRLSGWQKFW 181

Query: 202 KVELPFAIPQIVASLTQTIMLSLSMVVVTALV 233
            + +PF++P +V ++  ++      VV + ++
Sbjct: 182 YLGVPFSMPGLVWNMMMSMSGGWFFVVASEMI 213

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target281 proline/glycine betaine ABC transporter, permease prote
315122235281 proline/glycine betaine ABC transporter, permease prote 1 1e-131
190892828281 proline/glycine betaine ABC transporter permease [Rhizo 1 3e-93
86358687281 proline/glycine betaine ABC transporter, permease prote 1 5e-92
150397506281 binding-protein-dependent transport systems inner membr 1 6e-91
307308504281 choline ABC transporter, permease protein [Sinorhizobiu 1 2e-90
15966153281 putative glycine betaine transport system permease ABC 1 6e-90
227822905281 proline/glycine betaine ABC transporter, permease prote 1 8e-90
241205792285 choline ABC transporter permease [Rhizobium leguminosar 1 5e-89
116253276305 transmembrane component of ABC transporter [Rhizobium l 1 5e-89
222149405281 ABC transporter membrane spanning protein (proline/glyc 1 3e-88
>gi|315122235|ref|YP_004062724.1| proline/glycine betaine ABC transporter, permease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 281 Back     alignment and organism information
 Score =  470 bits (1210), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/279 (86%), Positives = 256/279 (91%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ IIQ  IPLGDYLQ FF  LT NGEWF + LSFILLK VN +LF+LQ+  PLV +C++
Sbjct: 1   MNWIIQTHIPLGDYLQAFFSYLTNNGEWFFSFLSFILLKIVNFILFLLQFFSPLVSICIL 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLLVL++KRSI I VGTAMGLLLI+ QGYWQETTETLSLVLVST ISM IGVPLGV AAW
Sbjct: 61  SLLVLVIKRSIAITVGTAMGLLLIVNQGYWQETTETLSLVLVSTSISMLIGVPLGVFAAW 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           YPRFYSIIRL LDSMQTIPTFVYLIPALVLFGLGMVPG+VATIVFSIPTSVRLTRLGIIS
Sbjct: 121 YPRFYSIIRLLLDSMQTIPTFVYLIPALVLFGLGMVPGMVATIVFSIPTSVRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP+LKEAA AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGS+GLGV
Sbjct: 181 TPPVLKEAARAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSDGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PVLRALNTVDIG+GFESG CIVI+AIILDRLFSIPDPRD
Sbjct: 241 PVLRALNTVDIGKGFESGFCIVIIAIILDRLFSIPDPRD 279


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892828|ref|YP_001979370.1| proline/glycine betaine ABC transporter permease [Rhizobium etli CIAT 652] Length = 281 Back     alignment and organism information
>gi|86358687|ref|YP_470579.1| proline/glycine betaine ABC transporter, permease protein [Rhizobium etli CFN 42] Length = 281 Back     alignment and organism information
>gi|150397506|ref|YP_001327973.1| binding-protein-dependent transport systems inner membrane component [Sinorhizobium medicae WSM419] Length = 281 Back     alignment and organism information
>gi|307308504|ref|ZP_07588206.1| choline ABC transporter, permease protein [Sinorhizobium meliloti BL225C] Length = 281 Back     alignment and organism information
>gi|15966153|ref|NP_386506.1| putative glycine betaine transport system permease ABC transporter protein [Sinorhizobium meliloti 1021] Length = 281 Back     alignment and organism information
>gi|227822905|ref|YP_002826877.1| proline/glycine betaine ABC transporter, permease protein [Sinorhizobium fredii NGR234] Length = 281 Back     alignment and organism information
>gi|241205792|ref|YP_002976888.1| choline ABC transporter permease [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 285 Back     alignment and organism information
>gi|116253276|ref|YP_769114.1| transmembrane component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 305 Back     alignment and organism information
>gi|222149405|ref|YP_002550362.1| ABC transporter membrane spanning protein (proline/glycine betaine) [Agrobacterium vitis S4] Length = 281 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target281 proline/glycine betaine ABC transporter, permease prote
TIGR03416267 TIGR03416, ABC_choXWV_perm, choline ABC transporter, pe 2e-90
COG4176290 COG4176, ProW, ABC-type proline/glycine betaine transpo 1e-73
PRK10952355 PRK10952, PRK10952, glycine betaine transporter membran 6e-49
COG0555274 COG0555, CysU, ABC-type sulfate transport system, perme 7e-08
COG1178540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 3e-07
COG1174221 COG1174, OpuBB, ABC-type proline/glycine betaine transp 1e-26
COG0600258 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate t 2e-17
TIGR01097250 TIGR01097, PhnE, phosphonate ABC transporter, permease 6e-14
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 2e-13
COG3639283 COG3639, COG3639, ABC-type phosphate/phosphonate transp 5e-12
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 1e-10
TIGR02138295 TIGR02138, phosphate_pstC, phosphate ABC transporter, p 5e-09
COG0765222 COG0765, HisM, ABC-type amino acid transport system, pe 3e-06
PRK10160275 PRK10160, PRK10160, taurine transporter subunit; Provis 6e-06
COG0601317 COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel t 1e-05
COG2011222 COG2011, AbcD, ABC-type metal ion transport system, per 5e-13
PRK10782217 PRK10782, PRK10782, DL-methionine transporter permease 2e-11
COG1173289 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel t 3e-09
TIGR00974271 TIGR00974, 3a0107s02c, phosphate ABC transporter, perme 3e-09
COG0573310 COG0573, PstC, ABC-type phosphate transport system, per 5e-09
COG0581292 COG0581, PstA, ABC-type phosphate transport system, per 5e-09
COG1177267 COG1177, PotC, ABC-type spermidine/putrescine transport 7e-09
COG1178 540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 2e-07
COG4149225 COG4149, ModC, ABC-type molybdate transport system, per 9e-07
TIGR02141208 TIGR02141, modB_ABC, molybdate ABC transporter, permeas 8e-06
TIGR01581225 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter 1e-05
TIGR03226312 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporte 2e-05
COG0395281 COG0395, UgpE, ABC-type sugar transport system, permeas 3e-05
PRK15082301 PRK15082, PRK15082, glutathione ABC transporter permeas 7e-05
PRK09421229 PRK09421, modB, molybdate ABC transporter permease prot 2e-04
PRK09881296 PRK09881, PRK09881, D-ala-D-ala transporter subunit; Pr 5e-04
TIGR02790258 TIGR02790, nickel_nikC, nickel ABC transporter, permeas 0.002
COG3833282 COG3833, MalG, ABC-type maltose transport systems, perm 0.003
COG4160228 COG4160, ArtM, ABC-type arginine/histidine transport sy 0.004
COG1176287 COG1176, PotB, ABC-type spermidine/putrescine transport 2e-05
TIGR03255272 TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport 0.003
>gnl|CDD|132457 TIGR03416, ABC_choXWV_perm, choline ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|33916 COG4176, ProW, ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182861 PRK10952, PRK10952, glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31367 COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30945 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162201 TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|33437 COG3639, COG3639, ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|162724 TIGR02138, phosphate_pstC, phosphate ABC transporter, permease protein PstC Back     alignment and domain information
>gnl|CDD|31108 COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182276 PRK10160, PRK10160, taurine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|30946 COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|32194 COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182726 PRK10782, PRK10782, DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|31366 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162141 TIGR00974, 3a0107s02c, phosphate ABC transporter, permease protein PstA Back     alignment and domain information
>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30926 COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31370 COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33901 COG4149, ModC, ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162726 TIGR02141, modB_ABC, molybdate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|130643 TIGR01581, Mo_ABC_porter, NifC-like ABC-type porter Back     alignment and domain information
>gnl|CDD|132270 TIGR03226, PhnU, 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>gnl|CDD|30744 COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185040 PRK15082, PRK15082, glutathione ABC transporter permease GsiD; Provisional Back     alignment and domain information
>gnl|CDD|181841 PRK09421, modB, molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|182131 PRK09881, PRK09881, D-ala-D-ala transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131837 TIGR02790, nickel_nikC, nickel ABC transporter, permease subunit NikC Back     alignment and domain information
>gnl|CDD|33626 COG3833, MalG, ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|33906 COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31369 COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132299 TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 281 proline/glycine betaine ABC transporter, permease prote
PRK10952354 glycine betaine transporter membrane protein; Provision 100.0
COG4176290 ProW ABC-type proline/glycine betaine transport system, 100.0
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 100.0
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 100.0
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 100.0
PRK10160275 taurine transporter subunit; Provisional 100.0
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 100.0
PRK10782217 DL-methionine transporter permease subunit; Provisional 100.0
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.96
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 99.95
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.94
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.91
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.89
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.89
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.88
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.88
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.88
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.88
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.87
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.86
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.86
PRK10683317 putrescine transporter subunit: membrane component of A 99.86
PRK10592281 putrescine transporter subunit: membrane component of A 99.85
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.84
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.84
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.83
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.83
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.82
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 99.82
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.8
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 99.8
PRK09494219 glnP glutamine ABC transporter permease protein; Review 99.8
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 99.79
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 99.78
TIGR03262 546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.76
PRK10352314 nickel transporter permease NikB; Provisional 99.75
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.75
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.75
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.74
COG4986523 ABC-type anion transport system, duplicated permease co 99.74
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 99.74
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 99.74
PRK10914339 dipeptide transporter permease DppB; Provisional 99.73
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.73
COG4986 523 ABC-type anion transport system, duplicated permease co 99.73
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.73
COG0765222 HisM ABC-type amino acid transport system, permease com 99.73
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.73
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 99.72
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 99.72
PRK10913300 dipeptide transporter; Provisional 99.72
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 99.71
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.7
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.69
PRK10998296 malG maltose transporter permease; Provisional 99.62
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 99.62
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 99.59
COG0395281 UgpE ABC-type sugar transport system, permease componen 99.58
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.55
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 99.5
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 99.43
COG4215230 ArtQ ABC-type arginine transport system, permease compo 99.42
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.34
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 99.25
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.23
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 99.23
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 99.21
COG4208287 CysW ABC-type sulfate transport system, permease compon 99.13
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 99.11
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 99.11
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.94
COG4209309 LplB ABC-type polysaccharide transport system, permease 98.89
COG4239341 ABC-type uncharacterized transport system, permease com 98.89
COG4132282 ABC-type uncharacterized transport system, permease com 98.54
COG4174364 ABC-type uncharacterized transport system, permease com 98.53
TIGR01253 519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 98.05
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 97.87
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.88
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.88
CHL00187235 cysT sulfate transport protein; Provisional 99.78
PRK10999520 malF maltose transporter membrane protein; Provisional 99.38
COG4135551 ABC-type uncharacterized transport system, permease com 98.41
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.85
COG4590733 ABC-type uncharacterized transport system, permease com 98.81
COG4597397 BatB ABC-type amino acid transport system, permease com 97.99
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 96.2
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4171 SapC ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065 This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target281 proline/glycine betaine ABC transporter, permease prote
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 1e-12
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 7e-04
3dhw_A217 D-methionine transport system permease protein METI; AB 7e-09
>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Length = 295 Back     alignment and structure
 Score = 68.9 bits (168), Expect = 1e-12
 Identities = 41/247 (16%), Positives = 85/247 (34%), Gaps = 17/247 (6%)

Query: 39  KAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLS 98
           K          +   L+ + +   L L       I    +  +     +        +L 
Sbjct: 30  KTRKFEPLTFVFSFLLLVLFLFIFLTLSNMIFEQITEDFSGLVKAAGNRSVISSIFLSLY 89

Query: 99  LVLVSTFISMFIGVPLGVLAAWYP-RFYSIIRLFLDSMQTIPTFVYLIPALVLFG----- 152
              ++T +++ +G P G + A +      ++   +D    +P  V  I  L +FG     
Sbjct: 90  AGFLATLLALLLGAPTGYILARFDFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLI 149

Query: 153 -----------LGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFR 201
                        +   +VA +  S+P      R G  S  P L+ AA + GA  ++ F 
Sbjct: 150 GEPLESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFF 209

Query: 202 KVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCI 261
            V LP +   ++     T   ++S      ++    +  P L     +  G      + +
Sbjct: 210 FVTLPLSARYLLIGSVMTWARAISEFGAVVILAYYPMVGPTLIYDRFISYGLSASRPIAV 269

Query: 262 VILAIIL 268
           +++ + L
Sbjct: 270 LLILVTL 276


>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Length = 514 Back     alignment and structure
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Length = 217 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 proline/glycine betaine ABC transporter, permease prote
3dhw_A217 D-methionine transport system permease protein METI; AB 99.94
2onk_C284 Molybdate/tungstate ABC transporter, permease protein; 99.9
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 99.9
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 99.75
2r6g_G296 Maltose transport system permease protein MALG; ABC tra 99.67
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Back     alignment and structure
Probab=99.94  E-value=4.3e-26  Score=174.24  Aligned_cols=190  Identities=27%  Similarity=0.388  Sum_probs=154.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--------HHHHHCCCHHHHHHHHCCCCCHHHH---H---HHHCCCC
Q ss_conf             449999999999999978876667764210121--------1232023503454420120210110---0---0000210
Q gi|254780341|r   89 YWQETTETLSLVLVSTFISMFIGVPLGVLAAWY--------PRFYSIIRLFLDSMQTIPTFVYLIP---A---LVLFGLG  154 (281)
Q Consensus        89 ~W~~~~~Tl~~~~~~~~ia~~igiplGi~~~~~--------~~~~~~~~p~l~~~~~iP~~v~l~p---~---i~~fG~g  154 (281)
                      +++...+|+.....++.++.++|+|+|+++++.        ++.++...++.+.++++|..+++..   .   ...++.|
T Consensus         9 ~l~~~~~Tl~~a~~~~~~~~~ig~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~   88 (217)
T 3dhw_A            9 LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIG   88 (217)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTCCSSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999864443200899999999999999999999999999999999861236


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             17889999998878999995887412998999999960788201012236886267999999999999999999999970
Q gi|254780341|r  155 MVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVG  234 (281)
Q Consensus       155 ~~~~i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~~vvia~~ig  234 (281)
                      ..+.+++..+++.|++.+++.+|++++|+++.|+||++|+|+||+++||.+|++.|++++|...+.+.++....+++++|
T Consensus        89 ~~~~ii~~~~~~~~~~~~~~~~~l~~i~~~~~eAA~~lGas~~q~f~~vilP~~~p~ii~~~~~~~~~~i~~~~i~~~ig  168 (217)
T 3dhw_A           89 LQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVG  168 (217)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCSTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998679999999999985898999998718989899969741997899999999999999999999999998


Q ss_pred             CCCHHHHHHHH-HHHHCHHHHHHHHHHHHH----HHHHHHHHHHHHHHH
Q ss_conf             58804999999-974078989999999999----999999999987421
Q gi|254780341|r  235 SNGLGVPVLRA-LNTVDIGRGFESGLCIVI----LAIILDRLFSIPDPR  278 (281)
Q Consensus       235 ~~GLG~~i~~a-~~~~~~~~~~~~~l~Iv~----lai~lDri~~~~~~r  278 (281)
                      .+|+|+...+. .+..|.+...+..+.+.+    +....|++.++.+||
T Consensus       169 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~rR  217 (217)
T 3dhw_A          169 AGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             CCHHHHHHHHHHHSSCCTTHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8799999999999860089999999999999999999999999975699



>2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: f.58.1.1 Back     alignment and structure
>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Back     alignment and structure
>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 281 proline/glycine betaine ABC transporter, permease prote
d3dhwa1203 f.58.1.1 (A:6-208) D-methionine transport system permea 5e-09
d3d31c1248 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, 0.003
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
 Score = 55.5 bits (133), Expect = 5e-09
 Identities = 53/192 (27%), Positives = 86/192 (44%), Gaps = 17/192 (8%)

Query: 95  ETLSLVLVSTFISMFIGVPLGVLAAWY--------PRFYSIIRLFLDSMQTIPTFVYL-- 144
           ETL++  VS F    IG+P+GVL             + Y  +   ++  ++IP  + L  
Sbjct: 10  ETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVW 69

Query: 145 ----IPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVF 200
                  +V   +G+   IV   V + P   R+    ++  P  L EA+ A GATP Q+ 
Sbjct: 70  MIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIV 129

Query: 201 RKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLC 260
           RKV LP A+P +V + T T++  +    +   VG+ GLG    +       G        
Sbjct: 130 RKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYI---GYNATVMNT 186

Query: 261 IVILAIILDRLF 272
           +++L +IL  L 
Sbjct: 187 VLVLLVILVYLI 198


>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 248 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 proline/glycine betaine ABC transporter, permease prote
d3dhwa1203 D-methionine transport system permease protein MetI {Es 99.93
d2onkc1252 Molybdate/tungstate transport system permease protein W 99.86
d3d31c1248 Sulfate/molybdate ABC transporter, permease protein {Me 99.85
d2r6gf2244 Maltose transport system permease protein MalF {Escheri 99.74
d2r6gg1290 Maltose transport system permease protein MalG {Escheri 99.73
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
Probab=99.93  E-value=2.1e-25  Score=168.67  Aligned_cols=180  Identities=29%  Similarity=0.408  Sum_probs=148.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--------CHHHHHCCCHHHHHHHHCCCCCHHHHHH------HHCCCCH
Q ss_conf             4999999999999997887666776421012--------1123202350345442012021011000------0002101
Q gi|254780341|r   90 WQETTETLSLVLVSTFISMFIGVPLGVLAAW--------YPRFYSIIRLFLDSMQTIPTFVYLIPAL------VLFGLGM  155 (281)
Q Consensus        90 W~~~~~Tl~~~~~~~~ia~~igiplGi~~~~--------~~~~~~~~~p~l~~~~~iP~~v~l~p~i------~~fG~g~  155 (281)
                      ++...+|+.+...++.++.++|+|+|+++++        +++..+...++...++++|..+++....      ..++.|.
T Consensus         5 l~~~~~tl~is~~~~~i~~ilg~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~~~~~~~~~~   84 (203)
T d3dhwa1           5 VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGL   84 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTCCSSSH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             99999999999999999999999999999998744432008999999999999999999999999998635540454119


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             78899999988789999958874129989999999607882010122368862679999999999999999999999705
Q gi|254780341|r  156 VPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGS  235 (281)
Q Consensus       156 ~~~i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~~vvia~~ig~  235 (281)
                      .+.+++..+++.|++.+++.+|++++|+|++|+||++|+|+||+++||.+|++.|.+++|.+.+...++....+++++|+
T Consensus        85 ~~~i~~~~~~~~p~~~~~~~~~l~~i~~~~~Eaa~~lGas~~q~~~~vilP~~~p~i~~~~~~~~~~~i~~~~~~~~ig~  164 (203)
T d3dhwa1          85 QAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGA  164 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCSTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999986489999999888843620689998869944424188409976999999999999999999999999977


Q ss_pred             CCHHHHHHHH-HHHHCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8804999999-9740789899999999999999999999
Q gi|254780341|r  236 NGLGVPVLRA-LNTVDIGRGFESGLCIVILAIILDRLFS  273 (281)
Q Consensus       236 ~GLG~~i~~a-~~~~~~~~~~~~~l~Iv~lai~lDri~~  273 (281)
                      +|+|+...+. .+++|...+....    .+.+++..+.+
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~----~~~~i~v~li~  199 (203)
T d3dhwa1         165 GGLGQIGYQYGYIGYNATVMNTVL----VLLVILVYLIQ  199 (203)
T ss_dssp             CHHHHHHHHHHHSSCCTTHHHHHH----HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHH----HHHHHHHHHHH
T ss_conf             599999999998740289999999----99999999999



>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r6gg1 f.58.1.1 (G:7-296) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 281 proline/glycine betaine ABC transporter, permease
3dhw_A_217 (A:) D-methionine transport system permease protei 4e-12
2r6g_F_269-326_360-453152 (F:269-326,F:360-453) Maltose transport system per 8e-12
2onk_C_69-249181 (C:69-249) Molybdate/tungstate ABC transporter, pe 7e-11
2r6g_G_73-244172 (G:73-244) Maltose transport system permease prote 8e-11
3d31_C_295 (C:) Sulfate/molybdate ABC transporter, permease p 1e-11
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12}Length = 217 Back     alignment and structure
 Score = 66.5 bits (162), Expect = 4e-12
 Identities = 51/201 (25%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 89  YWQETTETLSLVLVSTFISMFIGVPLGVLAAWY--------PRFYSIIRLFLDSMQTIPT 140
             +   ETL++  VS F    IG+P+GVL             + Y  +   ++  ++IP 
Sbjct: 9   LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPF 68

Query: 141 FVYLI------PALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
            + L+        +V   +G+   IV   V + P   R+    ++  P  L EA+ A GA
Sbjct: 69  IILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 128

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG-VPVLRALNTVDIGR 253
           TP Q+ RKV LP A+P +V + T T++  +    +   VG+ GLG +         +   
Sbjct: 129 TPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATV 188

Query: 254 GFESGLCIVILAIILDRLFSI 274
                + +VIL  ++      
Sbjct: 189 MNTVLVLLVILVYLIQFAGDR 209


>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 152 Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus}Length = 181 Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 172 Back     alignment and structure
>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 proline/glycine betaine ABC transporter, permease prote
3dhw_A_217 D-methionine transport system permease protein MET 99.92
3d31_C_295 Sulfate/molybdate ABC transporter, permease protei 99.91
2onk_C_69-249181 Molybdate/tungstate ABC transporter, permease prot 99.85
2r6g_F_269-326_360-453152 Maltose transport system permease protein MALF; AB 99.82
2r6g_G_73-244172 Maltose transport system permease protein MALG; AB 99.81
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure
Probab=99.92  E-value=9.2e-25  Score=167.15  Aligned_cols=191  Identities=28%  Similarity=0.383  Sum_probs=158.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH--------HHHHCCCHHHHHHHHCCCCCHHHHHH------HHCCC
Q ss_conf             84499999999999999788766677642101211--------23202350345442012021011000------00021
Q gi|254780341|r   88 GYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP--------RFYSIIRLFLDSMQTIPTFVYLIPAL------VLFGL  153 (281)
Q Consensus        88 g~W~~~~~Tl~~~~~~~~ia~~igiplGi~~~~~~--------~~~~~~~p~l~~~~~iP~~v~l~p~i------~~fG~  153 (281)
                      .+|+...+|+.....++.++.++|+++|+.+++++        +......+....++.+|.++++....      ..++.
T Consensus         8 ~l~~~l~~tl~~~~~~~~i~~vig~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (217)
T 3dhw_A            8 LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSI   87 (217)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTCCSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999999999999999999999999987344320189999999999999999999999999986455204530


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             01788999999887899999588741299899999996078820101223688626799999999999999999999997
Q gi|254780341|r  154 GMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALV  233 (281)
Q Consensus       154 g~~~~i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~~vvia~~i  233 (281)
                      +..+.+++..+++.|++.+++.++++++|+++.|+|+++|+|+||+++||.+|+++|.+++|+..+.+.++....++|++
T Consensus        88 ~~~~~ii~~~~~~~~~i~~~~~~~l~~i~~~~~eaA~~lG~s~~q~~~~v~lP~~~p~i~~~~~~~~~~~~~~~~~~~~i  167 (217)
T 3dhw_A           88 GLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAV  167 (217)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCST
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             18899898899724689899998888615027788860698742142673099769999999999999999999999999


Q ss_pred             CCCCHHHHHHH-HHHHHCHHHHHHHHHHHHHHHH----HHHHHHHHHHHH
Q ss_conf             05880499999-9974078989999999999999----999999987421
Q gi|254780341|r  234 GSNGLGVPVLR-ALNTVDIGRGFESGLCIVILAI----ILDRLFSIPDPR  278 (281)
Q Consensus       234 g~~GLG~~i~~-a~~~~~~~~~~~~~l~Iv~lai----~lDri~~~~~~r  278 (281)
                      |.+|+|+.... +.+.+|.+......+...++.+    +.|++.++.+||
T Consensus       168 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~~l~~~~~rR  217 (217)
T 3dhw_A          168 GAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             TCCHHHHHHHHHHHSSCCTTHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             87599999999999750189999999999999999999999999985699



>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure