254780342

254780342

substrate-binding region of ABC-type glycine betaine transport system

GeneID in NCBI database:8209327Locus tag:CLIBASIA_01135
Protein GI in NCBI database:254780342Protein Accession:YP_003064755.1
Gene range:-(238316, 239245)Protein Length:309aa
Gene description:substrate-binding region of ABC-type glycine betaine transport system
COG prediction:[E] ABC-type proline/glycine betaine transport systems, periplasmic components
KEGG prediction:substrate-binding region of ABC-type glycine betaine transport system; K02002 glycine betaine/proline transport system substrate-binding protein
SEED prediction:putative glycine betaine-binding ABC transporter protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN
cHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccEEEccccccccHHHHHHHHHcccEEEEcccccccEEEEEEcHHHHHcccccHHHHHHHHHHccccEEcccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcccccccccccccHHHEEEcHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHcccHHHccEEEEccccccHHHHHHHHHHHHHHHcccccccEEEccccEEHHHcccccccEEEcccccccHHHHHHHHHcccEEEccccccccEEEEccHHHHHHcccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHccccEEEEccccccccccEEEEEcccccccccccccEEEEEccccHHHHcccHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHcccEEcccccHHHHHHHHHcc
MYKILAVCLFLTTFSISyardadsctpvrfadtgwtdiaaTTAMTSVILEEILGYKTNIKLLAVPVTFRslknkgidifmgywypsLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGakiygiepgnegnQRILDMINNNKFSLKGFRLIEASELASFSQIRRdqrnnipavflswephpinsdlnihylpggeeisgfgeaSVYTVVRsdyldkcpnisRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLigvttfdgqdpsrqleRFMNN
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYgiepgnegnqRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVttfdgqdpsrqlerfmnn
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN
MYKILAVCLFLTTFSI***********VRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFM**
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMN*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN
MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target309 substrate-binding region of ABC-type glycine betaine tr
315122234310 substrate-binding region of ABC-type glycine betaine tr 1 1e-132
150397505318 substrate-binding region of ABC-type glycine betaine tr 1 3e-81
19880073309 ProX [Sinorhizobium meliloti] Length = 309 1 3e-80
15966152318 putative glycine betaine-binding ABC transporter protei 1 3e-80
254503371314 putative ABC transporter, QAT family, substrate-binding 1 3e-79
118589796314 putative glycine betaine-binding abc transporter protei 1 3e-78
218662463318 choline ABC transporter, periplasmic binding protein [R 1 3e-78
222086661318 proline/glycine betaine ABC transporter [Agrobacterium 1 9e-78
159185139317 ABC transporter, substrate binding protein (proline/gly 1 1e-77
224824408312 choline ABC transporter, periplasmic binding protein [L 1 1e-77
>gi|315122234|ref|YP_004062723.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 310 Back     alignment and organism information
 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/310 (75%), Positives = 277/310 (89%), Gaps = 1/310 (0%)

Query: 1   MYKILAVCLFLTT-FSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNI 59
           MYK+L   +F +T FS+ YA+D+D C PV F+DTGWTDI  TT+MTSVILEEILGYKTNI
Sbjct: 1   MYKVLGFIVFFSTAFSMGYAKDSDFCAPVHFSDTGWTDITTTTSMTSVILEEILGYKTNI 60

Query: 60  KLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDV 119
           KLL++PVT R+LKNK ID+FMGYWYPS EK IAPY++EGSIK+VAENLQGAKYMLAVND 
Sbjct: 61  KLLSMPVTLRALKNKDIDVFMGYWYPSHEKSIAPYVKEGSIKVVAENLQGAKYMLAVNDA 120

Query: 120 GFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELAS 179
           GFALGIKSYQDIAKY ++LG KIYGI+PGN GNQRILDMI ++KFSLK FRLIEASE AS
Sbjct: 121 GFALGIKSYQDIAKYSQQLGYKIYGIDPGNNGNQRILDMIQSDKFSLKNFRLIEASEQAS 180

Query: 180 FSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCP 239
           F+Q+RR+Q+NNIPAVFLSWEPHPIN DLNIHYL GGE+ISGFG+ASVYTVVRSDY+DKCP
Sbjct: 181 FAQVRRNQKNNIPAVFLSWEPHPINLDLNIHYLLGGEDISGFGKASVYTVVRSDYIDKCP 240

Query: 240 NISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDP 299
           N+ RLLKNIKFSVALENEMMKL+L++K+D + VGR +LR++PDLLK WL+GVT F+G+DP
Sbjct: 241 NVGRLLKNIKFSVALENEMMKLVLHDKKDPKSVGRDILRSNPDLLKGWLVGVTRFNGEDP 300

Query: 300 SRQLERFMNN 309
             ++E+F+ N
Sbjct: 301 LSEVEKFIKN 310


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397505|ref|YP_001327972.1| substrate-binding region of ABC-type glycine betaine transport system [Sinorhizobium medicae WSM419] Length = 318 Back     alignment and organism information
>gi|19880073|gb|AAM00244.1|AF360731_1 ProX [Sinorhizobium meliloti] Length = 309 Back     alignment and organism information
>gi|15966152|ref|NP_386505.1| putative glycine betaine-binding ABC transporter protein [Sinorhizobium meliloti 1021] Length = 318 Back     alignment and organism information
>gi|254503371|ref|ZP_05115522.1| putative ABC transporter, QAT family, substrate-binding protein [Labrenzia alexandrii DFL-11] Length = 314 Back     alignment and organism information
>gi|118589796|ref|ZP_01547201.1| putative glycine betaine-binding abc transporter protein [Stappia aggregata IAM 12614] Length = 314 Back     alignment and organism information
>gi|218662463|ref|ZP_03518393.1| choline ABC transporter, periplasmic binding protein [Rhizobium etli IE4771] Length = 318 Back     alignment and organism information
>gi|222086661|ref|YP_002545195.1| proline/glycine betaine ABC transporter [Agrobacterium radiobacter K84] Length = 318 Back     alignment and organism information
>gi|159185139|ref|NP_355237.2| ABC transporter, substrate binding protein (proline/glycine betaine) [Agrobacterium tumefaciens str. C58] Length = 317 Back     alignment and organism information
>gi|224824408|ref|ZP_03697516.1| choline ABC transporter, periplasmic binding protein [Lutiella nitroferrum 2002] Length = 312 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target309 substrate-binding region of ABC-type glycine betaine tr
TIGR03414290 TIGR03414, ABC_choline_bnd, choline ABC transporter, pe 1e-109
COG2113302 COG2113, ProX, ABC-type proline/glycine betaine transpo 5e-63
pfam04069256 pfam04069, OpuAC, Substrate binding domain of ABC-type 9e-34
>gnl|CDD|132455 TIGR03414, ABC_choline_bnd, choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>gnl|CDD|32296 COG2113, ProX, ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|146609 pfam04069, OpuAC, Substrate binding domain of ABC-type glycine betaine transport system Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 309 substrate-binding region of ABC-type glycine betaine tr
TIGR03414290 ABC_choline_bnd choline ABC transporter, periplasmic bi 100.0
PRK11119332 proX glycine betaine transporter periplasmic subunit; P 100.0
COG2113302 ProX ABC-type proline/glycine betaine transport systems 100.0
COG4521334 TauA ABC-type taurine transport system, periplasmic com 99.21
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, periplasm 98.21
COG1638332 DctP TRAP-type C4-dicarboxylate transport system, perip 97.96
pfam04069256 OpuAC Substrate binding domain of ABC-type glycine beta 100.0
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding (lipo 100.0
PRK11553314 alkanesulfonate transporter substrate-binding subunit; 99.71
PRK11480320 tauA taurine transporter substrate binding subunit; Pro 99.54
TIGR01729304 taurine_ABC_bnd taurine ABC transporter, periplasmic bi 98.78
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 98.66
PRK11063271 metQ DL-methionine transporter substrate-binding subuni 98.64
COG3221299 PhnD ABC-type phosphate/phosphonate transport system, p 98.28
COG1464268 NlpA ABC-type metal ion transport system, periplasmic c 98.23
TIGR01728311 SsuA_fam ABC transporter, substrate-binding protein, al 98.22
COG4143336 TbpA ABC-type thiamine transport system, periplasmic co 98.14
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 98.13
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 97.74
COG2998280 TupB ABC-type tungstate transport system, permease comp 97.64
TIGR01096333 3A0103s03R lysine-arginine-ornithine-binding periplasmi 97.02
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 96.82
pfam03180236 Lipoprotein_9 NLPA lipoprotein. This family of bacteria 96.39
PRK12681324 cysB transcriptional regulator CysB; Reviewed 96.27
PRK12680327 transcriptional regulator CysB-like protein; Reviewed 96.13
COG4134384 ABC-type uncharacterized transport system, periplasmic 95.88
PRK12683308 transcriptional regulator CysB-like protein; Reviewed 94.35
PRK12684313 transcriptional regulator CysB-like protein; Reviewed 93.58
PRK12682309 transcriptional regulator CysB-like protein; Reviewed 92.01
PRK11622401 putative ABC transporter solute-binding protein; Provis 90.9
COG0715335 TauA ABC-type nitrate/sulfonate/bicarbonate transport s 99.09
pfam09084216 NMT1 NMT1/THI5 like. This family contains the NMT1 and 98.96
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 98.94
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding protei 98.83
TIGR01098299 3A0109s03R phosphonate ABC transporter, periplasmic pho 98.74
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 98.35
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 98.32
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glutamat 97.78
PRK11260264 cystine transporter subunit; Provisional 97.63
cd00134218 PBPb Bacterial periplasmic transport systems use membra 96.15
TIGR02424300 TF_pcaQ pca operon transcription factor PcaQ; InterPro: 95.52
pfam03466209 LysR_substrate LysR substrate binding domain. The struc 95.45
PRK09791302 putative DNA-binding transcriptional regulator; Provisi 94.93
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 94.57
smart00062219 PBPb Bacterial periplasmic substrate-binding proteins. 94.52
PRK11242292 DNA-binding transcriptional regulator CynR; Provisional 94.41
PRK09986278 DNA-binding transcriptional activator XapR; Provisional 94.24
CHL00180307 rbcR LysR transcriptional regulator; Provisional 93.78
PRK10341312 DNA-binding transcriptional activator TdcA; Provisional 93.24
pfam00497224 SBP_bac_3 Bacterial extracellular solute-binding protei 90.27
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 98.27
COG2358321 Imp TRAP-type uncharacterized transport system, peripla 98.26
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 98.14
COG0687363 PotD Spermidine/putrescine-binding periplasmic protein 96.76
PRK11205326 tbpA thiamine transporter substrate binding subunit; Pr 96.42
PRK04168336 hypothetical protein; Provisional 94.87
PRK10682370 putrescine transporter subunit: periplasmic-binding com 97.63
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 95.39
COG2984322 ABC-type uncharacterized transport system, periplasmic 92.63
PRK09508314 leuO leucine transcriptional activator; Reviewed 92.44
PRK01066234 porphobilinogen deaminase; Provisional 91.66
COG1910223 Periplasmic molybdate-binding protein/domain [Inorganic 95.42
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4521 TauA ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein; InterPro: IPR010068 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family; InterPro: IPR010067 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein; InterPro: IPR005768 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>pfam03180 Lipoprotein_9 NLPA lipoprotein Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11622 putative ABC transporter solute-binding protein; Provisional Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam09084 NMT1 NMT1/THI5 like Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>TIGR01098 3A0109s03R phosphonate ABC transporter, periplasmic phosphonate-binding protein; InterPro: IPR005770 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ; InterPro: IPR012787 Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate Back     alignment and domain information
>pfam03466 LysR_substrate LysR substrate binding domain Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>pfam00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>PRK01066 porphobilinogen deaminase; Provisional Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target309 substrate-binding region of ABC-type glycine betaine tr
2reg_A298 Abc-Transporter Choline Binding Protein In Complex 7e-60
3l6g_A256 Crystal Structure Of Lactococcal Opuac In Its Open 2e-39
3ppn_A311 Structures Of The Substrate-Binding Protein Provide 2e-28
1r9l_A309 Structure Analysis Of Prox In Complex With Glycine 2e-26
1sw2_A275 Crystal Structure Of Prox From Archeoglobus Fulgidu 1e-23
1sw4_A275 Crystal Structure Of Prox From Archeoglobus Fulgidu 2e-23
3o66_A282 Crystal Structure Of Glycine BetaineCARNITINECHOLIN 2e-22
3mam_A270 A Molecular Switch Changes The Low To The High Affi 6e-22
1sw1_A275 Crystal Structure Of Prox From Archeoglobus Fulgidu 1e-21
2b4l_A268 Crystal Structure Of The Binding Protein Opuac In C 4e-25
2b4l_A268 Crystal Structure Of The Binding Protein Opuac In C 3e-08
>gi|203282240|pdb|2REG|A Chain A, Abc-Transporter Choline Binding Protein In Complex With Choline Length = 298 Back     alignment and structure
 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 139/290 (47%), Positives = 200/290 (68%), Gaps = 3/290 (1%)

Query: 20  RDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIF 79
            + +SC  VRF+D GWTDI ATTA  + ILE  LGY+T++K+L+VPVT+ SLKNK ID+F
Sbjct: 1   AEPESCGTVRFSDVGWTDITATTATATTILEA-LGYETDVKVLSVPVTYTSLKNKDIDVF 59

Query: 80  MGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELG 139
           +G W P++E  IAPY E+ S++ V ENL GAKY LA N  G  LGIK ++DIA +K EL 
Sbjct: 60  LGNWMPTMEADIAPYREDKSVETVRENLAGAKYTLATNAKGAELGIKDFKDIAAHKDELD 119

Query: 140 AKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWE 199
            KIYGIEPGN+GN+ I+DM+    F LKGF ++E+SE    +Q+ R +++  P VFL WE
Sbjct: 120 GKIYGIEPGNDGNRLIIDMVEKGTFDLKGFEVVESSEQGMLAQVARAEKSGDPIVFLGWE 179

Query: 200 PHPINSDLNIHYLPGGEEIS--GFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENE 257
           PHP+N++  + YL GG+++    +G A+V+T VR+ Y  +CPN+ +LL+N+ FS+ +ENE
Sbjct: 180 PHPMNANFKLTYLSGGDDVFGPNYGGATVHTNVRAGYTTECPNVDKLLQNLSFSLQMENE 239

Query: 258 MMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFM 307
           +M  ILN+ +D +      L+ +P  ++ WL GV T DG D    ++  +
Sbjct: 240 IMGKILNDGEDPEKAAAAWLKDNPQSIEPWLSGVATKDGGDGLAAVKAAL 289


>gi|296278460|pdb|3L6G|A Chain A, Crystal Structure Of Lactococcal Opuac In Its Open Conformat Length = 256 Back     alignment and structure
>gi|332639767|pdb|3PPN|A Chain A, Structures Of The Substrate-Binding Protein Provide Insights Into The Multiple Compatible Solutes Binding Specificities Of Bacillus Subtilis Abc Transporter Opuc Length = 311 Back     alignment and structure
>gi|46015450|pdb|1R9L|A Chain A, Structure Analysis Of Prox In Complex With Glycine Betaine Length = 309 Back     alignment and structure
>gi|55669782|pdb|1SW2|A Chain A, Crystal Structure Of Prox From Archeoglobus Fulgidus In Complex With Glycine Betaine Length = 275 Back     alignment and structure
>gi|55669783|pdb|1SW4|A Chain A, Crystal Structure Of Prox From Archeoglobus Fulgidus In Complex With Trimethyl Ammonium Length = 275 Back     alignment and structure
>gi|303325167|pdb|3O66|A Chain A, Crystal Structure Of Glycine BetaineCARNITINECHOLINE ABC TRANSPORTER Length = 282 Back     alignment and structure
>gi|327533576|pdb|3MAM|A Chain A, A Molecular Switch Changes The Low To The High Affinity State In The Substrate Binding Protein Afprox Length = 270 Back     alignment and structure
>gi|55669780|pdb|1SW1|A Chain A, Crystal Structure Of Prox From Archeoglobus Fulgidus In Complex With Proline Betaine Length = 275 Back     alignment and structure
>gi|93278789|pdb|2B4L|A Chain A, Crystal Structure Of The Binding Protein Opuac In Complex With Glycine Betaine Length = 268 Back     alignment and structure
>gi|93278789|pdb|2B4L|A Chain A, Crystal Structure Of The Binding Protein Opuac In Complex With Glycine Betaine Length = 268 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target309 substrate-binding region of ABC-type glycine betaine tr
2rin_A298 Putative glycine betaine-binding ABC transporter protei 6e-57
3l6g_A256 Betaine ABC transporter permease and substrate BI prote 3e-40
1r9l_A309 Glycine betaine-binding periplasmic protein; periplasmi 7e-36
1sw5_A275 Osmoprotection protein (PROX); binding-protein, compati 7e-20
3o66_A282 Glycine betaine/carnitine/choline ABC transporter; stru 8e-18
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 2e-32
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 1e-16
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Length = 298 Back     alignment and structure
 Score =  216 bits (550), Expect = 6e-57
 Identities = 139/280 (49%), Positives = 196/280 (70%), Gaps = 3/280 (1%)

Query: 21  DADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFM 80
           + +SC  VRF+D GWTDI ATTA  + ILE  LGY+T++K+L+VPVT+ SLKNK ID+F+
Sbjct: 2   EPESCGTVRFSDVGWTDITATTATATTILEA-LGYETDVKVLSVPVTYTSLKNKDIDVFL 60

Query: 81  GYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGA 140
           G W P++E  IAPY E+ S++ V ENL GAKY LA N  G  LGIK ++DIA +K EL  
Sbjct: 61  GNWMPTMEADIAPYREDKSVETVRENLAGAKYTLATNAKGAELGIKDFKDIAAHKDELDG 120

Query: 141 KIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEP 200
           KIYGIEPGN+GN+ I+DM+    F LKGF ++E+SE    +Q+ R +++  P VFL WEP
Sbjct: 121 KIYGIEPGNDGNRLIIDMVEKGTFDLKGFEVVESSEQGMLAQVARAEKSGDPIVFLGWEP 180

Query: 201 HPINSDLNIHYLPGGEE--ISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEM 258
           HP+N++  + YL GG++     +G A+V+T VR+ Y  +CPN+ +LL+N+ FS+ +ENE+
Sbjct: 181 HPMNANFKLTYLSGGDDVFGPNYGGATVHTNVRAGYTTECPNVDKLLQNLSFSLQMENEI 240

Query: 259 MKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQD 298
           M  ILN+ +D +      L+ +P  ++ WL GV T DG D
Sbjct: 241 MGKILNDGEDPEKAAAAWLKDNPQSIEPWLSGVATKDGGD 280


>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Length = 256 Back     alignment and structure
>1r9l_A Glycine betaine-binding periplasmic protein; periplasmic binding protein, cation-PI interactions, tryptophan BOX, protein binding; 1.59A {Escherichia coli} SCOP: c.94.1.1 PDB: 1r9q_A* Length = 309 Back     alignment and structure
>1sw5_A Osmoprotection protein (PROX); binding-protein, compatible solutes, cation-PI interactions, non-classical hydrogen bonds; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: c.94.1.1 PDB: 1sw4_A 1sw1_A 1sw2_A Length = 275 Back     alignment and structure
>3o66_A Glycine betaine/carnitine/choline ABC transporter; structural genomics, PSI-2, protein structure initiative; HET: PGE; 1.86A {Staphylococcus aureus subsp} Length = 282 Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Length = 268 Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Length = 268 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target309 substrate-binding region of ABC-type glycine betaine tr
2rin_A298 Putative glycine betaine-binding ABC transporter protei 100.0
3l6g_A256 Betaine ABC transporter permease and substrate BI prote 100.0
1r9l_A309 Glycine betaine-binding periplasmic protein; periplasmi 100.0
2hzl_A365 Trap-T family sorbitol/mannitol transporter, periplasmi 97.92
2nxo_A291 Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10 97.84
2zzv_A361 ABC transporter, solute-binding protein; periplasmic su 97.16
3b50_A310 Sialic acid-binding periplasmic protein SIAP; periplasm 95.59
2vpn_A316 Periplasmic substrate binding protein; ectoine, hydroxy 95.32
2hpg_A327 ABC transporter, periplasmic substrate-binding protein; 90.99
3fxb_A326 Trap dicarboxylate transporter, DCTP subunit; periplasm 90.77
3o66_A282 Glycine betaine/carnitine/choline ABC transporter; stru 100.0
1sw5_A275 Osmoprotection protein (PROX); binding-protein, compati 100.0
1p99_A295 Hypothetical protein PG110; structural genomics, PSI, p 99.15
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L-meth 98.6
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine cultur 98.02
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, struct 97.85
2qry_A330 Thiamine-binding periplasmic protein; thiamin binding p 97.41
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 96.83
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 96.77
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 96.47
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 96.35
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 96.2
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, struct 94.65
2pt1_A334 Iron transport protein; C-clamp, iron-binding protein, 94.3
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 94.16
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 94.15
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 100.0
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 99.83
3kn3_A242 Putative periplasmic protein; alpha-beta structure, per 96.29
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-bindin 99.41
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; tran 99.37
2de3_A365 Dibenzothiophene desulfurization enzyme B; alpha-beta, 99.04
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine prote 98.74
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 98.66
3k2d_A237 ABC-type metal ION transport system, periplasmic; alpha 98.66
3hn0_A283 Nitrate transport protein; YP_001302749.1, structural g 98.43
2g29_A417 Nitrate transport protein NRTA; solute-binding protein, 98.36
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 98.15
2i49_A429 Bicarbonate transporter; alpha-beta protein, C-clamp, A 97.67
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 97.0
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 95.98
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 95.92
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 95.48
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 95.09
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 94.82
1wdn_A226 GLNBP, glutamine binding protein; closed form, complex, 93.8
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 92.91
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 92.09
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 90.73
1us5_A314 Putative GLUR0 ligand binding core; receptor, membrane 98.18
3n5l_A310 Binding protein component of ABC phosphonate TRAN; stru 97.97
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 96.71
3muq_A237 Uncharacterized conserved protein; structural genomics, 96.7
3del_B242 Arginine binding protein; alpha and beta protein (A/B), 96.31
3g41_A246 Amino acid ABC transporter, periplasmic amino acid-bind 95.8
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 95.8
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 94.13
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 96.6
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 96.27
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- bindi 95.45
3c9h_A355 ABC transporter, substrate binding protein; structural 93.8
3ecr_A364 Porphobilinogen deaminase; heme biosynthesis, porphobil 90.99
2vha_A287 Periplasmic binding transport protein; periplasmic bind 96.34
3omb_A 535 Extracellular solute-binding protein, family 1; PSI-2, 91.8
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure
Probab=100.00  E-value=0  Score=462.12  Aligned_cols=288  Identities=49%  Similarity=0.895  Sum_probs=275.8

Q ss_pred             CCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHCCC
Q ss_conf             58345883799425886999999999999961069848998564057888851498139998404641356666553047
Q gi|254780342|r   20 RDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGS   99 (309)
Q Consensus        20 ~~~~~~~~I~ig~~~wte~~v~a~i~~~iLE~~lGy~Ve~~~~~~~~~~~al~~G~iD~~~e~w~p~~~~~~~~~~~~~~   99 (309)
                      +.|++++||+||+++|+|+.++++|++++||+ +||+|+++.++++++|+||++|+||+|+|||+|.....+.+...++.
T Consensus         1 a~p~~~~~V~ig~~~w~~~~~~a~i~~~vLe~-~Gy~Ve~~~~~~~~~~~al~~GdID~~~e~W~p~~~~~~~~~~~~~~   79 (298)
T 2rin_A            1 AEPESCGTVRFSDVGWTDITATTATATTILEA-LGYETDVKVLSVPVTYTSLKNKDIDVFLGNWMPTMEADIAPYREDKS   79 (298)
T ss_dssp             ---CCTTEEEEECCSCHHHHHHHHHHHHHHHH-HTCEEEEECCCHHHHHHHHHHTSCCEEEEEEETTTHHHHHHHHTTTS
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             98144897699746976699999999999998-69924898687099999998799808840466400166799886145


Q ss_pred             EEEECCCCCCCEEEEEEEHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCCEEEECCCCCCH
Q ss_conf             02301356685356786344641234553565555665442013578543200555876640354522100103665201
Q gi|254780342|r  100 IKLVAENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELAS  179 (309)
Q Consensus       100 ~~~~~~~~~~~~~~~~v~~~~~~~~i~~~~dl~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~s~~~~  179 (309)
                      ++.++.++.+...+++|+.+.++++|++|+||.++.+.|+++++||++++.+........+.|+|++.++++..+++++|
T Consensus        80 ~~~l~~~~~~~~~~~~v~~~~a~~~i~sisDL~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~a~  159 (298)
T 2rin_A           80 VETVRENLAGAKYTLATNAKGAELGIKDFKDIAAHKDELDGKIYGIEPGNDGNRLIIDMVEKGTFDLKGFEVVESSEQGM  159 (298)
T ss_dssp             EEEEEEEEEEEEEEEEEEHHHHHHTCCBGGGSGGGHHHHTSEEECCSTTCHHHHHHHHHHHHTGGGCTTCEEECCCHHHH
T ss_pred             CEECCCCCCCCEEEEEECCHHHHCCCCCHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHCCCCCCCEECCCCHHHH
T ss_conf             31114445686158875304444276747777653552377467225642224331456665026887654204646779


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCHHHHCCCCEEECCCCCCCC--CCHHHHHHHHCHHHHHHCHHHHHHHHHCCCCHHHHHH
Q ss_conf             89999999659936999412422320158514007865467--7865835442777787488999998740899899999
Q gi|254780342|r  180 FSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISG--FGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALENE  257 (309)
Q Consensus       180 ~a~l~~A~~~~~~~v~~~wsp~~~~~~~dl~~Ledp~~~~~--~p~~~~~~vv~~~~~~~~P~~~~~L~~~~ls~~~~~~  257 (309)
                      ++++++|+++|+|+++++|+|||++.+|+|++|+||++.|+  +|.+++.+++|++|+++||+++++|++++|++++|++
T Consensus       160 ~a~l~~A~~~~~~~v~~~w~p~~~~~~~dL~~LeDp~~~~~~~~~a~~v~~v~~~~~~~~~P~~~~~L~~~~l~~~~m~~  239 (298)
T 2rin_A          160 LAQVARAEKSGDPIVFLGWEPHPMNANFKLTYLSGGDDVFGPNYGGATVHTNVRAGYTTECPNVDKLLQNLSFSLQMENE  239 (298)
T ss_dssp             HHHHHHHHHTTCCCEEEEEESSTHHHHSCEEECBSCTTTTCHHHHEEEEEEEEETTHHHHSHHHHHHHHHCCCCHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCHHHHHH
T ss_conf             99999998468857998268732220376478058854468887620000287566777697999999967799999999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHC
Q ss_conf             999998459998999999999859999987547545677137999998744
Q gi|254780342|r  258 MMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMN  308 (309)
Q Consensus       258 l~~~v~~~g~~~~~vA~~wL~~n~~~~~~Wl~~~~~~~~~~~~~~~~~~~~  308 (309)
                      ||++|+++|++|++||++||++|+++|++||+||+|.||+|+.++||.+++
T Consensus       240 ln~~v~~~g~~~~~vA~~wL~~n~~~v~~Wl~g~~~~~~~d~~~~~~~~~~  290 (298)
T 2rin_A          240 IMGKILNDGEDPEKAAAAWLKDNPQSIEPWLSGVATKDGGDGLAAVKAALG  290 (298)
T ss_dssp             HHHHHHTTCCCHHHHHHHHHHHSGGGHHHHTTTCBCTTSSBHHHHHHHHHT
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHCCCCCCCCCCHHHHHHHHCC
T ss_conf             999998649999999999999797999999668777777508999999749



>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Back     alignment and structure
>1r9l_A Glycine betaine-binding periplasmic protein; periplasmic binding protein, cation-PI interactions, tryptophan BOX, protein binding; 1.59A {Escherichia coli} SCOP: c.94.1.1 PDB: 1r9q_A* Back     alignment and structure
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A Back     alignment and structure
>2nxo_A Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10093F, PSI-2, structural genomics, protein structure initiative; 2.04A {Streptomyces coelicolor} SCOP: c.94.1.1 Back     alignment and structure
>2zzv_A ABC transporter, solute-binding protein; periplasmic substrate binding protein, calcium, lactate, trap transporter, transport protein; 1.40A {Thermus thermophilus} PDB: 2zzw_A 2zzx_A Back     alignment and structure
>3b50_A Sialic acid-binding periplasmic protein SIAP; periplasmic binding protein, trap, sugar transport, transport, transport protein; HET: SLB; 1.40A {Haemophilus influenzae} PDB: 2v4c_A* 2cey_A 2cex_A Back     alignment and structure
>2vpn_A Periplasmic substrate binding protein; ectoine, hydroxyectoine, trap-transporter, periplasmic binding protein, transport; HET: 4CS; 1.55A {Halomonas elongata} PDB: 2vpo_A* 3gyy_A Back     alignment and structure
>2hpg_A ABC transporter, periplasmic substrate-binding protein; periplasmic binding protein, thermophilic proteins, trap- transport; HET: MSE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3fxb_A Trap dicarboxylate transporter, DCTP subunit; periplasmic substrate binding protein, selectivity helix, membrane, transport protein; HET: 4CS; 2.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3o66_A Glycine betaine/carnitine/choline ABC transporter; structural genomics, PSI-2, protein structure initiative; HET: PGE; 1.86A {Staphylococcus aureus subsp} Back     alignment and structure
>1sw5_A Osmoprotection protein (PROX); binding-protein, compatible solutes, cation-PI interactions, non-classical hydrogen bonds; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: c.94.1.1 PDB: 1sw4_A 1sw1_A 1sw2_A Back     alignment and structure
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1 Back     alignment and structure
>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} Back     alignment and structure
>3ir1_A Outer membrane lipoprotein GNA1946; D-methionine cultured, protein binding; 2.15A {Neisseria meningitidis} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding domain, cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>1amf_A Molybdate transport protein MODA; periplasmic, binding protein; 1.75A {Escherichia coli} SCOP: c.94.1.1 PDB: 1wod_A Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Archaeoglobus fulgidus dsm 4304} SCOP: c.94.1.1 Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, structural genomics, PSI-2; HET: GTT CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>3k2d_A ABC-type metal ION transport system, periplasmic; alpha/beta domain, immune system; 2.60A {Vibrio vulnificus} Back     alignment and structure
>3hn0_A Nitrate transport protein; YP_001302749.1, structural genomics, joint center for structural genomics, JCSG; 1.75A {Parabacteroides distasonis} Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic solute-binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- plasmid, transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, protein binding, transport protein; 1.92A {Chlamydia trachomatis} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure