254780357

254780357

hypothetical protein CLIBASIA_01210

GeneID in NCBI database:8209342Locus tag:CLIBASIA_01210
Protein GI in NCBI database:254780357Protein Accession:YP_003064770.1
Gene range:+(253661, 254845)Protein Length:394aa
Gene description:hypothetical protein
COG prediction:[R] Predicted membrane metal-binding protein
KEGG prediction:hypothetical protein
SEED prediction:DNA internalization-related competence protein ComEC/Rec2
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED4 TM-Helix
HMMTOP6 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI
ccccccccccccHHHHHHHHHHccccHHccccccHHHHHHHHHHHHHHHEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccEEccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccEEEcccccEEEEEccccEEEEEccccEEEHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEcccEEEEEEEEHHHHHHHHHHccccccEEEEEEcHHHHHccccEEEEEEcccccccEEEEEEHHHHHccccccccccc
cccEEEcccccccccEEEEEEEcccccccccccccccHHHHHEccccccHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccEEEEccccEEEEEccccEEEEcccccccHHHHHHHHccccccccccccccccHHHcccHHHccccccccccEEEccccEEEEEcccccEEEEEccHHHHHHHHccccEEEEcccccccccccccEEEcHHHHHHcccEEEEEccccccccccEEEEEEEccccccccHcccc
mlsitkkydpfpaettiegiarlsppsgpafpglfdfnfssyykgisaigyfysipkmiysseshntwTWKKISSIKQSFLNEIRANigtygsasASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSldnipfgvmaWGLDIIIHIAHRISVAHnefcigripetsFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILftfpysfspdlliseKGNLVALVDKntlisnysnppsfifSQWKsalitpfheaphvqkedlqEKNQSSLKEILRSMqprkflcikksfcvgchrsDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEIlqkqgsleitiippsndndkVKFIIKSAIEnlhfpwtkhri
mlsitkkydpfpaETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIkksfcvgchRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILqkqgsleitiippsndnDKVKFIIKSAienlhfpwtkhri
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNirhigsimigitiiiLFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI
*********PFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWT****
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPH***********SSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI
*LSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEA****KEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPW*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI
MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target394 hypothetical protein CLIBASIA_01210 [Candidatus Liberib
190891621820 hypothetical protein RHECIAT_CH0002024 [Rhizobium etli 1 4e-45
190891621 820 hypothetical protein RHECIAT_CH0002024 [Rhizobium etli 1 2e-08
86357548848 hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42 1 4e-45
86357548 848 hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42 1 3e-07
327189235820 hypothetical protein RHECNPAF_70025 [Rhizobium etli CNP 1 2e-44
327189235 820 hypothetical protein RHECNPAF_70025 [Rhizobium etli CNP 1 2e-08
218463027527 hypothetical protein RetlK5_27913 [Rhizobium etli Kim 5 1 1e-43
209549196810 ComEC/Rec2-related protein [Rhizobium leguminosarum bv. 1 2e-42
209549196 810 ComEC/Rec2-related protein [Rhizobium leguminosarum bv. 1 7e-08
116251991830 transmembrane DNA uptake competence-related protein [Rh 1 7e-39
>gi|190891621|ref|YP_001978163.1| hypothetical protein RHECIAT_CH0002024 [Rhizobium etli CIAT 652] Length = 820 Back     alignment and organism information
 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 173/318 (54%), Gaps = 23/318 (7%)

Query: 92  GSASASIFLIKHFHCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAW 151
           G  S ++F I+HFH +  YGL AN+  +PI+SF+V+PAGL+A+LLM   LD   + V+ +
Sbjct: 488 GGFSTALFSIEHFHRLTAYGLPANLATMPIISFIVMPAGLLAMLLMPFGLDAPLWTVVGF 547

Query: 152 GLDIIIHIAHRISVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIII 211
           GLD++I +A  +S    +   GR+P   FV  V  FLL+   +T +RH G+ ++ +  +I
Sbjct: 548 GLDLVIAVAKTVSGWGGDIGFGRLPGWYFVVAVAGFLLLTLLRTRLRHAGTSILAVATLI 607

Query: 212 LFTFPYSFSPDLLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHV-- 269
           L   P S  PDL+ISE G LV LV    + SN  NPP FIF QW+ AL+ P H  P +  
Sbjct: 608 LLILPGSPPPDLVISEDGGLVGLVAATAMASNRENPPDFIFDQWQRALVLPTHHPPKMLD 667

Query: 270 ------QKEDL--------QEKNQSSLKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVL 315
                 Q ED         Q + ++++       +  +F C+KK++C+    +  +V V+
Sbjct: 668 GPAIPPQGEDRRVKLSRDQQNEARTAMVAAAAGGEANRFSCVKKAWCIARLGNGNVVAVI 727

Query: 316 KRKDMIRLSCQLSDILITTIRDINTKLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVK 375
                +  +C   +I++T++R    +  + + L T E L++ GS+E+  +   ++     
Sbjct: 728 DNAAYLGPACDAGEIVVTSVRLRFDRCRSGATLFTGETLRRTGSVELRFVQTGHE----- 782

Query: 376 FIIKSAIENLHFPWTKHR 393
             I +A + L  PW +HR
Sbjct: 783 --IATAFDALSRPWMRHR 798


Species: Rhizobium etli
Genus: Rhizobium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891621|ref|YP_001978163.1| hypothetical protein RHECIAT_CH0002024 [Rhizobium etli CIAT 652] Length = 820 Back     alignment and organism information
>gi|86357548|ref|YP_469440.1| hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42] Length = 848 Back     alignment and organism information
>gi|86357548|ref|YP_469440.1| hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42] Length = 848 Back     alignment and organism information
>gi|327189235|gb|EGE56414.1| hypothetical protein RHECNPAF_70025 [Rhizobium etli CNPAF512] Length = 820 Back     alignment and organism information
>gi|327189235|gb|EGE56414.1| hypothetical protein RHECNPAF_70025 [Rhizobium etli CNPAF512] Length = 820 Back     alignment and organism information
>gi|218463027|ref|ZP_03503118.1| hypothetical protein RetlK5_27913 [Rhizobium etli Kim 5] Length = 527 Back     alignment and organism information
>gi|209549196|ref|YP_002281113.1| ComEC/Rec2-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 810 Back     alignment and organism information
>gi|209549196|ref|YP_002281113.1| ComEC/Rec2-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 810 Back     alignment and organism information
>gi|116251991|ref|YP_767829.1| transmembrane DNA uptake competence-related protein [Rhizobium leguminosarum bv. viciae 3841] Length = 830 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target394 hypothetical protein CLIBASIA_01210 [Candidatus Liberib
PRK11539755 PRK11539, PRK11539, ComEC family competence protein; Pr 2e-04
TIGR00361662 TIGR00361, ComEC_Rec2, DNA internalization-related comp 4e-04
pfam03772270 pfam03772, Competence, Competence protein 2e-08
>gnl|CDD|183185 PRK11539, PRK11539, ComEC family competence protein; Provisional Back     alignment and domain information
>gnl|CDD|161839 TIGR00361, ComEC_Rec2, DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>gnl|CDD|146422 pfam03772, Competence, Competence protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 394 hypothetical protein CLIBASIA_01210 [Candidatus Liberib
PRK11539754 hypothetical protein; Provisional 99.89
pfam03772270 Competence Competence protein. Members of this family a 99.88
TIGR00361 731 ComEC_Rec2 DNA internalization-related competence prote 98.89
COG0658453 ComEC Predicted membrane metal-binding protein [General 98.18
TIGR00360187 ComEC_N-term ComEC/Rec2-related protein; InterPro: IPR0 97.55
PRK11539 754 hypothetical protein; Provisional 97.77
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information
>pfam03772 Competence Competence protein Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2; InterPro: IPR004797 This is the DNA internalisation-related competence protein ComEC/Rec2 family Back     alignment and domain information
>COG0658 ComEC Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00360 ComEC_N-term ComEC/Rec2-related protein; InterPro: IPR004477 This family is defined to identify a pair of paralogous 3' exoribonucleases in Escherichia coli, plus the set of proteins apparently orthologous to one or the other in other eubacteria Back     alignment and domain information
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00