255764464

255764464

Cytidine/deoxycytidylate deaminase, zinc-binding region

GeneID in NCBI database:8209343Locus tag:CLIBASIA_01215
Protein GI in NCBI database:255764464Protein Accession:YP_003064771.2
Gene range:+(255669, 256118)Protein Length:149aa
Gene description:Cytidine/deoxycytidylate deaminase, zinc-binding region
COG prediction:[F] [J] Cytosine/adenosine deaminases
KEGG prediction:cytidine/deoxycytidylate deaminase, zinc-binding region
SEED prediction:tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
cccHHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccEEEEEEEcccccccccHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEccccccccccccHHHHHHHHHHHHHHHccccEccccEEEEEccccHHHHHHHHHccccEEEEcccccccccccHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHcc
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISragnrnrelkdVTAHAEILAIRMGCRilsqeilpevdlyvtlepCTMCAAAISLARIRRLYygasnpkgggiengtqfytlatchhspeiypgiseQRSRQIIQDFFKERR
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIisragnrnrelkdVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPeiypgiseqrsRQIIQDFFKERR
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCaaaislarirrlYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
**KGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
**KGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR
MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
315122181150 Cytidine/deoxycytidylate deaminase, zinc-binding region 1 1e-67
306840968157 cytidine and deoxycytidylate deaminase family protein [ 1 2e-50
222085014152 cytosine deaminase protein [Agrobacterium radiobacter K 1 3e-50
15888031152 cytidine and deoxycytidylate deaminase [Agrobacterium t 1 6e-50
254719939157 cytidine and deoxycytidylate deaminase family protein [ 1 9e-50
306845521157 cytidine and deoxycytidylate deaminase family protein [ 1 2e-49
225628666171 cytidine and deoxycytidylate deaminase family protein [ 1 2e-49
62317152157 cytidine and deoxycytidylate deaminase family protein [ 1 2e-49
225686059157 cytidine and deoxycytidylate deaminase family protein [ 1 2e-49
17989385204 cytosine deaminase [Brucella melitensis bv. 1 str. 16M] 1 2e-49
>gi|315122181|ref|YP_004062670.1| Cytidine/deoxycytidylate deaminase, zinc-binding region [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 150 Back     alignment and organism information
 Score =  259 bits (662), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/145 (85%), Positives = 131/145 (90%)

Query: 5   NVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCR 64
           N FMS ALEEA NA+LRNEIPVGAVAVLNNKII RAGNRNRELKDVTAHAEILAIRM C+
Sbjct: 5   NNFMSLALEEALNASLRNEIPVGAVAVLNNKIIGRAGNRNRELKDVTAHAEILAIRMSCQ 64

Query: 65  ILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHH 124
            LSQE LP VDLYVTLEPCTMCAAAIS ARIRRLYYGASNPKGG IENG +FYTLATCHH
Sbjct: 65  TLSQETLPGVDLYVTLEPCTMCAAAISFARIRRLYYGASNPKGGAIENGIEFYTLATCHH 124

Query: 125 SPEIYPGISEQRSRQIIQDFFKERR 149
            PEIY GI+E+RS+QI+Q FFKERR
Sbjct: 125 KPEIYSGIAEKRSKQIMQKFFKERR 149


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|306840968|ref|ZP_07473709.1| cytidine and deoxycytidylate deaminase family protein [Brucella sp. BO2] Length = 157 Back     alignment and organism information
>gi|222085014|ref|YP_002543543.1| cytosine deaminase protein [Agrobacterium radiobacter K84] Length = 152 Back     alignment and organism information
>gi|15888031|ref|NP_353712.1| cytidine and deoxycytidylate deaminase [Agrobacterium tumefaciens str. C58] Length = 152 Back     alignment and organism information
>gi|254719939|ref|ZP_05181750.1| cytidine and deoxycytidylate deaminase family protein [Brucella sp. 83/13] Length = 157 Back     alignment and organism information
>gi|306845521|ref|ZP_07478090.1| cytidine and deoxycytidylate deaminase family protein [Brucella sp. BO1] Length = 157 Back     alignment and organism information
>gi|225628666|ref|ZP_03786700.1| cytidine and deoxycytidylate deaminase family protein [Brucella ceti str. Cudo] Length = 171 Back     alignment and organism information
>gi|62317152|ref|YP_223005.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 1 str. 9-941] Length = 157 Back     alignment and organism information
>gi|225686059|ref|YP_002734031.1| cytidine and deoxycytidylate deaminase family protein [Brucella melitensis ATCC 23457] Length = 157 Back     alignment and organism information
>gi|17989385|ref|NP_542018.1| cytosine deaminase [Brucella melitensis bv. 1 str. 16M] Length = 204 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
cd01285109 cd01285, nucleoside_deaminase, Nucleoside deaminases in 4e-29
pfam00383104 pfam00383, dCMP_cyt_deam_1, Cytidine and deoxycytidylat 6e-21
cd01284115 cd01284, Riboflavin_deaminase-reductase, Riboflavin-spe 9e-09
TIGR00326 344 TIGR00326, eubact_ribD, riboflavin biosynthesis protein 2e-08
cd01286131 cd01286, deoxycytidylate_deaminase, Deoxycytidylate dea 3e-06
cd0078696 cd00786, cytidine_deaminase-like, Cytidine and deoxycyt 7e-06
COG2131164 COG2131, ComEB, Deoxycytidylate deaminase [Nucleotide t 1e-05
KOG3127230 KOG3127, KOG3127, KOG3127, Deoxycytidylate deaminase [N 1e-04
PRK10860172 PRK10860, PRK10860, tRNA-specific adenosine deaminase; 1e-26
KOG1018169 KOG1018, KOG1018, KOG1018, Cytosine deaminase FCY1 and 2e-22
COG0117146 COG0117, RibD, Pyrimidine deaminase [Coenzyme metabolis 5e-11
COG0590152 COG0590, CumB, Cytosine/adenosine deaminases [Nucleotid 8e-39
KOG2771344 KOG2771, KOG2771, KOG2771, Subunit of tRNA-specific ade 1e-07
PHA02588168 PHA02588, cd, deoxycytidylate deaminase; Provisional 3e-04
>gnl|CDD|29828 cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases Back     alignment and domain information
>gnl|CDD|144101 pfam00383, dCMP_cyt_deam_1, Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>gnl|CDD|29827 cd01284, Riboflavin_deaminase-reductase, Riboflavin-specific deaminase Back     alignment and domain information
>gnl|CDD|161819 TIGR00326, eubact_ribD, riboflavin biosynthesis protein RibD Back     alignment and domain information
>gnl|CDD|29829 cd01286, deoxycytidylate_deaminase, Deoxycytidylate deaminase domain Back     alignment and domain information
>gnl|CDD|29825 cd00786, cytidine_deaminase-like, Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>gnl|CDD|32314 COG2131, ComEB, Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|38337 KOG3127, KOG3127, KOG3127, Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|182786 PRK10860, PRK10860, tRNA-specific adenosine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|36236 KOG1018, KOG1018, KOG1018, Cytosine deaminase FCY1 and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30466 COG0117, RibD, Pyrimidine deaminase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|30935 COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|37982 KOG2771, KOG2771, KOG2771, Subunit of tRNA-specific adenosine-34 deaminase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177417 PHA02588, cd, deoxycytidylate deaminase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 149 Cytidine/deoxycytidylate deaminase, zinc-binding region
PRK10860178 tRNA-specific adenosine deaminase; Provisional 100.0
COG0590152 CumB Cytosine/adenosine deaminases [Nucleotide transpor 100.0
PRK10786 367 ribD bifunctional diaminohydroxyphosphoribosylaminopyri 100.0
KOG1018169 consensus 100.0
TIGR00326 393 eubact_ribD riboflavin biosynthesis protein RibD; Inter 100.0
COG0117146 RibD Pyrimidine deaminase [Coenzyme metabolism] 99.97
KOG2771344 consensus 99.85
cd01285109 nucleoside_deaminase Nucleoside deaminases include aden 100.0
pfam00383104 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase 100.0
cd01284115 Riboflavin_deaminase-reductase Riboflavin-specific deam 99.96
cd01286131 deoxycytidylate_deaminase Deoxycytidylate deaminase dom 99.93
cd0078696 cytidine_deaminase-like Cytidine and deoxycytidylate de 99.9
COG2131164 ComEB Deoxycytidylate deaminase [Nucleotide transport a 99.82
KOG3127230 consensus 99.6
TIGR02571151 ComEB ComE operon protein 2; InterPro: IPR013404 This i 99.3
cd01283112 cytidine_deaminase Cytidine deaminase zinc-binding doma 98.26
PRK12411132 cytidine deaminase; Provisional 98.05
COG0295134 Cdd Cytidine deaminase [Nucleotide transport and metabo 97.76
PRK05578132 cytidine deaminase; Validated 97.72
TIGR01354135 cyt_deam_tetra cytidine deaminase; InterPro: IPR006262 97.58
PRK06848139 hypothetical protein; Validated 97.38
PRK08298128 cytidine deaminase; Validated 97.3
KOG0833173 consensus 95.64
PRK09027295 cytidine deaminase; Provisional 94.6
pfam08210116 APOBEC_N APOBEC-like N-terminal domain. A mechanism of 93.21
>PRK10860 tRNA-specific adenosine deaminase; Provisional Back     alignment and domain information
>COG0590 CumB Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>KOG1018 consensus Back     alignment and domain information
>TIGR00326 eubact_ribD riboflavin biosynthesis protein RibD; InterPro: IPR004794 This entry describes the riboflavin biosynthesis protein (ribD) as found in Escherichia coli Back     alignment and domain information
>COG0117 RibD Pyrimidine deaminase [Coenzyme metabolism] Back     alignment and domain information
>KOG2771 consensus Back     alignment and domain information
>cd01285 nucleoside_deaminase Nucleoside deaminases include adenosine, guanine and cytosine deaminases Back     alignment and domain information
>pfam00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>cd01284 Riboflavin_deaminase-reductase Riboflavin-specific deaminase Back     alignment and domain information
>cd01286 deoxycytidylate_deaminase Deoxycytidylate deaminase domain Back     alignment and domain information
>cd00786 cytidine_deaminase-like Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>COG2131 ComEB Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3127 consensus Back     alignment and domain information
>TIGR02571 ComEB ComE operon protein 2; InterPro: IPR013404 This is encoded in the ComE operon for "late competence" as characterised in B Back     alignment and domain information
>cd01283 cytidine_deaminase Cytidine deaminase zinc-binding domain Back     alignment and domain information
>PRK12411 cytidine deaminase; Provisional Back     alignment and domain information
>COG0295 Cdd Cytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05578 cytidine deaminase; Validated Back     alignment and domain information
>TIGR01354 cyt_deam_tetra cytidine deaminase; InterPro: IPR006262 Cytidine deaminase is a small homotetrameric zinc metalloprotein Back     alignment and domain information
>PRK06848 hypothetical protein; Validated Back     alignment and domain information
>PRK08298 cytidine deaminase; Validated Back     alignment and domain information
>KOG0833 consensus Back     alignment and domain information
>PRK09027 cytidine deaminase; Provisional Back     alignment and domain information
>pfam08210 APOBEC_N APOBEC-like N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
3ocq_A183 Crystal Structure Of Trna-Specific Adenosine Deamin 3e-36
1z3a_A168 Crystal Structure Of Trna Adenosine Deaminase Tada 8e-36
2b3j_A159 Crystal Structure Of Staphylococcus Aureus Trna Ade 1e-34
2a8n_A144 Biochemical And Structural Studies Of A-To-I Editin 7e-29
2nx8_A179 The Crystal Structure Of The Trna-Specific Adenosin 3e-28
1wwr_A171 Crystal Structure Of Trna Adenosine Deaminase Tada 5e-28
3dh1_A189 Crystal Structure Of Human Trna-Specific Adenosine- 2e-20
2b3z_A 373 Crystal Structure Of A Bifunctional Deaminase And R 4e-20
2hxv_A 360 Crystal Structure Of A Diaminohydroxyphosphoribosyl 6e-19
2o7p_A 380 The Crystal Structure Of Ribd From Escherichia Coli 2e-17
2g6v_A 402 The Crystal Structure Of Ribd From Escherichia Coli 2e-17
1ysb_A161 Yeast Cytosine Deaminase Triple Mutant Length = 161 1e-10
2o3k_A161 Yeast Cytosine Deaminase D92e Triple Mutant Bound T 1e-10
1ysd_A161 Yeast Cytosine Deaminase Double Mutant Length = 161 2e-10
1p6o_A161 The Crystal Structure Of Yeast Cytosine Deaminase B 3e-10
1uaq_A158 The Crystal Structure Of Yeast Cytosine Deaminase L 5e-10
1ox7_A161 Crystal Structure Of Yeast Cytosine Deaminase Apo-E 2e-07
2g84_A197 Cytidine And Deoxycytidylate Deaminase Zinc-Binding 0.003
1tiy_A164 X-Ray Structure Of Guanine Deaminase From Bacillus 3e-12
1wkq_A164 Crystal Structure Of Bacillus Subtilis Guanine Deam 5e-12
gi|303325222|pdb|3OCQ|A Chain A, Crystal Structure Of Trna-Specific Adenosine Deaminase From Salmonella Enterica Length = 183 Back     alignment and structure
 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/147 (38%), Positives = 77/147 (52%)

Query: 3   KGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMG 62
               +M  AL  A+ A    E+PVGAV V N+++I    NR     D TAHAEI+A+R G
Sbjct: 18  DHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGWNRPIGRHDPTAHAEIMALRQG 77

Query: 63  CRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATC 122
             +L    L +  LYVTLEPC MCA A+  +RI R+ +GA + K G   +          
Sbjct: 78  GLVLQNYRLLDTTLYVTLEPCVMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLHHPGM 137

Query: 123 HHSPEIYPGISEQRSRQIIQDFFKERR 149
           +H  EI  G+       ++ DFF+ RR
Sbjct: 138 NHRVEIIEGVLRDECATLLSDFFRMRR 164


>gi|90108580|pdb|1Z3A|A Chain A, Crystal Structure Of Trna Adenosine Deaminase Tada From Escherichia Coli Length = 168 Back     alignment and structure
>gi|88192205|pdb|2B3J|A Chain A, Crystal Structure Of Staphylococcus Aureus Trna Adenosine Deaminase, Tada, In Complex With Rna Length = 159 Back     alignment and structure
>gi|78101280|pdb|2A8N|A Chain A, Biochemical And Structural Studies Of A-To-I Editing By Trna:a34 Deaminases At The Wobble Position Of Transfer Rna Length = 144 Back     alignment and structure
>gi|159794935|pdb|2NX8|A Chain A, The Crystal Structure Of The Trna-Specific Adenosine Deaminase From Streptococcus Pyogenes Length = 179 Back     alignment and structure
>gi|60593936|pdb|1WWR|A Chain A, Crystal Structure Of Trna Adenosine Deaminase Tada From Aquifex Aeolicus Length = 171 Back     alignment and structure
>gi|198443277|pdb|3DH1|A Chain A, Crystal Structure Of Human Trna-Specific Adenosine-34 Deaminase Subunit Adat2 Length = 189 Back     alignment and structure
>gi|83754218|pdb|2B3Z|A Chain A, Crystal Structure Of A Bifunctional Deaminase And Reductase Involved In Riboflavin Biosynthesis Length = 373 Back     alignment and structure
>gi|114794616|pdb|2HXV|A Chain A, Crystal Structure Of A Diaminohydroxyphosphoribosylaminopyrimidine Deaminase 5-Amino-6-(5-Phosphoribosylamino)uracil Reductase (Tm1828) From Thermotoga Maritima At 1.80 A Resolution Length = 360 Back     alignment and structure
>gi|134105070|pdb|2O7P|A Chain A, The Crystal Structure Of Ribd From Escherichia Coli In Complex With The Oxidised Nadp+ Cofactor In The Active Site Of The Reductase Domain Length = 380 Back     alignment and structure
>gi|126030525|pdb|2G6V|A Chain A, The Crystal Structure Of Ribd From Escherichia Coli Length = 402 Back     alignment and structure
>gi|67464318|pdb|1YSB|A Chain A, Yeast Cytosine Deaminase Triple Mutant Length = 161 Back     alignment and structure
>gi|158429187|pdb|2O3K|A Chain A, Yeast Cytosine Deaminase D92e Triple Mutant Bound To Transition State Analogue Hpy Length = 161 Back     alignment and structure
>gi|67464322|pdb|1YSD|A Chain A, Yeast Cytosine Deaminase Double Mutant Length = 161 Back     alignment and structure
>gi|34810531|pdb|1P6O|A Chain A, The Crystal Structure Of Yeast Cytosine Deaminase Bound To 4(R)-Hydroxyl-3,4-Dihydropyrimidine At 1.14 Angstroms. Length = 161 Back     alignment and structure
gi|30750134|pdb|1UAQ|A Chain A, The Crystal Structure Of Yeast Cytosine Deaminase Length = 158 Back     alignment and structure
>gi|34810500|pdb|1OX7|A Chain A, Crystal Structure Of Yeast Cytosine Deaminase Apo-Enzyme: Inorganic Zinc Bound Length = 161 Back     alignment and structure
>gi|93279919|pdb|2G84|A Chain A, Cytidine And Deoxycytidylate Deaminase Zinc-Binding Region From Nitrosomonas Europaea. Length = 197 Back     alignment and structure
>gi|50513754|pdb|1TIY|A Chain A, X-Ray Structure Of Guanine Deaminase From Bacillus Subtilis Northeast Structural Genomics Consortium Target Sr160 Length = 164 Back     alignment and structure
>gi|51248026|pdb|1WKQ|A Chain A, Crystal Structure Of Bacillus Subtilis Guanine Deaminase. The First Domain-Swapped Structure In The Cytidine Deaminase Superfamily Length = 164 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
1p6o_A161 Cytosine deaminase; hydrolase, dimer, inhibitor bound; 2e-29
1wwr_A171 TRNA adenosine deaminase TADA; homodimer, riken structu 7e-29
3dh1_A189 TRNA-specific adenosine deaminase 2; zinc-binding prote 2e-27
2a8n_A144 Cytidine and deoxycytidylate deaminase; RNA editing, RN 5e-26
2b3j_A159 TRNA adenosine deaminase; mixed alpha-beta, protein-RNA 3e-25
2nx8_A179 TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00 1e-24
1wkq_A164 Guanine deaminase; domain SWAP, the cytidine deaminase 6e-24
2g84_A197 Cytidine and deoxycytidylate deaminase zinc- binding re 1e-22
1z3a_A168 TRNA-specific adenosine deaminase; tRNA adenosine deami 2e-22
2hxv_A 360 Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 3e-15
2g6v_A 402 Riboflavin biosynthesis protein RIBD; RIBD APO structur 1e-13
1vq2_A193 DCMP deaminase, deoxycytidylate deaminase; hydrolase; H 1e-06
2b3z_A 373 Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, 1e-14
2hvw_A184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwic 4e-14
2w4l_A178 DCMP deaminse, deoxycytidylate deaminase; pyrimidine me 4e-11
>1p6o_A Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae} SCOP: c.97.1.2 PDB: 1ox7_A 1rb7_A 1ysd_A 1ysb_A 2o3k_A 1uaq_A Length = 161 Back     alignment and structure
 Score =  123 bits (309), Expect = 2e-29
 Identities = 34/145 (23%), Positives = 56/145 (38%), Gaps = 11/145 (7%)

Query: 7   FMSCALEEAQNAALRNEIPVGAVAVL--NNKIISRAGNRNRELKDVTAHAEILAIRMGCR 64
            M  A EEA        +P+G   +   +  ++ R  N   +    T H EI  +   C 
Sbjct: 17  GMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLEN-CG 75

Query: 65  ILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHH 124
            L  ++  +  LY TL PC MC  AI +  I R   G +         G ++        
Sbjct: 76  RLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSK---GEKYL-----QT 127

Query: 125 SPEIYPGISEQRSRQIIQDFFKERR 149
                  + ++R ++I++ F  ER 
Sbjct: 128 RGHEVVVVDDERCKKIMKQFIDERP 152


>1wwr_A TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} SCOP: c.97.1.2 Length = 171 Back     alignment and structure
>3dh1_A TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens} Length = 189 Back     alignment and structure
>2a8n_A Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens} SCOP: c.97.1.2 Length = 144 Back     alignment and structure
>2b3j_A TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp} SCOP: c.97.1.2 Length = 159 Back     alignment and structure
>2nx8_A TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6} Length = 179 Back     alignment and structure
>1wkq_A Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis} SCOP: c.97.1.2 PDB: 1tiy_A Length = 164 Back     alignment and structure
>2g84_A Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718} SCOP: c.97.1.2 Length = 197 Back     alignment and structure
>1z3a_A TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli} SCOP: c.97.1.2 Length = 168 Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Length = 360 Back     alignment and structure
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Length = 402 Back     alignment and structure
>1vq2_A DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4} SCOP: c.97.1.2 Length = 193 Back     alignment and structure
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Length = 373 Back     alignment and structure
>2hvw_A Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Length = 184 Back     alignment and structure
>2w4l_A DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 178 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
1wwr_A171 TRNA adenosine deaminase TADA; homodimer, riken structu 100.0
2nx8_A179 TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00 100.0
2b3j_A159 TRNA adenosine deaminase; mixed alpha-beta, protein-RNA 100.0
3dh1_A189 TRNA-specific adenosine deaminase 2; zinc-binding prote 100.0
2a8n_A144 Cytidine and deoxycytidylate deaminase; RNA editing, RN 100.0
1z3a_A168 TRNA-specific adenosine deaminase; tRNA adenosine deami 100.0
2g84_A197 Cytidine and deoxycytidylate deaminase zinc- binding re 100.0
1p6o_A161 Cytosine deaminase; hydrolase, dimer, inhibitor bound; 100.0
1wkq_A164 Guanine deaminase; domain SWAP, the cytidine deaminase 100.0
2g6v_A 402 Riboflavin biosynthesis protein RIBD; RIBD APO structur 100.0
2hxv_A 360 Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 100.0
2b3z_A 373 Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, 100.0
1vq2_A193 DCMP deaminase, deoxycytidylate deaminase; hydrolase; H 99.96
2w4l_A178 DCMP deaminse, deoxycytidylate deaminase; pyrimidine me 99.93
2hvw_A184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwic 99.95
3b8f_A142 Putative blasticidin S deaminase; cytidine deaminase, s 98.27
1r5t_A142 Cytidine deaminase; zinc dependent deaminase, RNA editi 97.86
2fr5_A146 Cytidine deaminase; zinc, tetrahydrouridine, protein- i 97.78
3mpz_A150 Cytidine deaminase; ssgcid, structu genomics, seattle s 97.64
2z3g_A130 Blasticidin-S deaminase; hydrolase, cytidine deaminase 97.18
3g8q_A 278 Predicted RNA-binding protein, contains thump domain; c 97.12
3oj6_A158 Blasticidin-S deaminase; ssgcid, seattle structural gen 96.6
1ctt_A294 Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escheri 96.22
2d30_A141 Cytidine deaminase; purines, pyrimidines, nucleosides, 97.87
3dmo_A138 Cytidine deaminase; structural genomics, seattle struct 97.78
1uwz_A136 Cytidine deaminase; CDD, tetramer, zinc binding, pyrimi 97.71
1ctt_A294 Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escheri 96.3
2nyt_A190 Probable C->U-editing enzyme apobec-2; cytidine deamina 94.81
>1wwr_A TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} SCOP: c.97.1.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=323.26  Aligned_cols=146  Identities=39%  Similarity=0.604  Sum_probs=141.8

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             56999999999999887579980899998389099987347354488642511344566664148854541168861677
Q gi|255764464|r    3 KGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEP   82 (149)
Q Consensus         3 ~d~~~M~~A~~~A~~a~~~g~~PvGaviv~~g~ii~~g~N~~~~~~d~t~HAEi~ai~~a~~~~~~~~l~~~tlYtTlEP   82 (149)
                      +||+||++||++|++|+..|++|||||||++|+||+.|+|++.+.+|||+|||++||++|+++++.++|+++|||||+||
T Consensus        22 ~~e~fM~~Al~~A~~a~~~g~~PVGaVIV~~~~ii~~g~n~~~~~~~~~~HAE~~ai~~a~~~~~~~~l~~~tlY~TlEP  101 (171)
T 1wwr_A           22 GKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYLEGCELYVTLEP  101 (171)
T ss_dssp             SHHHHHHHHHHHHHHHHHTTSCCCEEEEEETTEEEEEEECCHHHHTCTTCCHHHHHHHHHHHHHTCSCCTTEEEEESSCC
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCC
T ss_conf             99999999999999861369998999999899698653366446999731499999999997608655678688531587


Q ss_pred             CHHHHHHHHHCCCCEEEEEECCCCCCEECCHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHC
Q ss_conf             6889899986088859997117988501741344431689999879928218999999899988409
Q gi|255764464|r   83 CTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR  149 (149)
Q Consensus        83 C~MC~~Ai~~agI~rVvyg~~d~~~g~~~~~~~~~~~~~~~~~~~v~~gvl~ee~~~Ll~~ff~~kR  149 (149)
                      |+||++||+|+||+|||||+.||+.|+.++..+++..+.++++++|.+|++ +||.+||++||++||
T Consensus       102 C~mC~~ai~~sgI~rVvyg~~D~~~g~~~~~~~~l~~~~~~~~~~v~~g~~-eE~~~Ll~~FF~~~R  167 (171)
T 1wwr_A          102 CIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVKWEYYPL-EEASELLSEFFKKLR  167 (171)
T ss_dssp             BHHHHHHHHHTTCSEEEESSCCTTTBTTTTSCCGGGCTTCSSCCEEEECCC-HHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCEEEEECH-HHHHHHHHHHHHHHH
T ss_conf             888999999858885999864799874344888876432489988997349-999999999999986



>2nx8_A TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6} Back     alignment and structure
>2b3j_A TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp} SCOP: c.97.1.2 Back     alignment and structure
>3dh1_A TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2a8n_A Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens} SCOP: c.97.1.2 Back     alignment and structure
>1z3a_A TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli} SCOP: c.97.1.2 Back     alignment and structure
>2g84_A Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718} SCOP: c.97.1.2 Back     alignment and structure
>1p6o_A Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae} SCOP: c.97.1.2 PDB: 1ox7_A 1rb7_A 1ysd_A 1ysb_A 2o3k_A 1uaq_A Back     alignment and structure
>1wkq_A Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis} SCOP: c.97.1.2 PDB: 1tiy_A Back     alignment and structure
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Back     alignment and structure
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Back     alignment and structure
>1vq2_A DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4} SCOP: c.97.1.2 Back     alignment and structure
>2w4l_A DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2hvw_A Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Back     alignment and structure
>3b8f_A Putative blasticidin S deaminase; cytidine deaminase, structural genomics, PSI-2, MCSG, protein structure initiative; 1.90A {Bacillus anthracis} Back     alignment and structure
>1r5t_A Cytidine deaminase; zinc dependent deaminase, RNA editing, apobec-1 related protein, hydrolase; 2.00A {Saccharomyces cerevisiae} SCOP: c.97.1.1 Back     alignment and structure
>2fr5_A Cytidine deaminase; zinc, tetrahydrouridine, protein- inhibitor complex, alternate conformation of Arg68, hydrolase; HET: TYU; 1.48A {Mus musculus} SCOP: c.97.1.1 PDB: 1zab_A* 2fr6_A* 1mq0_A* Back     alignment and structure
>3mpz_A Cytidine deaminase; ssgcid, structu genomics, seattle structural genomics center for infectious hydrolase; 1.70A {Mycobacterium smegmatis} PDB: 3ijf_X Back     alignment and structure
>2z3g_A Blasticidin-S deaminase; hydrolase, cytidine deaminase family, zinc, tetramer; HET: TRE; 1.50A {Aspergillus terreus} SCOP: c.97.1.1 PDB: 1wn6_A* 1wn5_A* 2z3h_A* 2z3j_A 2z3i_A* Back     alignment and structure
>3g8q_A Predicted RNA-binding protein, contains thump domain; cytidine deaminase, ferredoxin-like domain; 2.40A {Methanopyrus kandleri} Back     alignment and structure
>3oj6_A Blasticidin-S deaminase; ssgcid, seattle structural genomics for infectious disease, hydrolase; 1.70A {Coccidioides immitis} Back     alignment and structure
>1ctt_A Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escherichia coli} SCOP: c.97.1.1 c.97.1.1 PDB: 1aln_A* 1af2_A* 1ctu_A* Back     alignment and structure
>2d30_A Cytidine deaminase; purines, pyrimidines, nucleosides, nucleotides, salvage of nucleosides and nucleotides, structural genomics; 2.40A {Bacillus anthracis} SCOP: c.97.1.1 Back     alignment and structure
>3dmo_A Cytidine deaminase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1uwz_A Cytidine deaminase; CDD, tetramer, zinc binding, pyrimidine metabolism, salvage, hydrolase; HET: THU; 1.99A {Bacillus subtilis} SCOP: c.97.1.1 PDB: 1ux0_A* 1jtk_A* 1ux1_A* Back     alignment and structure
>1ctt_A Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escherichia coli} SCOP: c.97.1.1 c.97.1.1 PDB: 1aln_A* 1af2_A* 1ctu_A* Back     alignment and structure
>2nyt_A Probable C->U-editing enzyme apobec-2; cytidine deaminase, zinc-ION binding, hydrolase; 2.50A {Homo sapiens} PDB: 2rpz_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 149 Cytidine/deoxycytidylate deaminase, zinc-binding region
d1wwra1151 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquif 1e-27
d2a8na1130 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deamina 5e-25
d2b3ja1151 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staph 2e-23
d2g84a1189 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomo 2e-23
d1wkqa_158 c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis 3e-23
d1z3aa1156 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Esch 1e-22
d1p6oa_156 c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccha 9e-21
d2b3za2145 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD 7e-14
d2hxva2147 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD 1e-11
d1vq2a_193 c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage 2e-10
>d1wwra1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]} Length = 151 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Cytidine deaminase-like
superfamily: Cytidine deaminase-like
family: Deoxycytidylate deaminase-like
domain: tRNA adenosine deaminase TadA
species: Aquifex aeolicus [TaxId: 63363]
 Score =  116 bits (290), Expect = 1e-27
 Identities = 58/143 (40%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 7   FMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRIL 66
           F+  AL EA+ A  + E+PVGA+ V   +IIS+A N   ELKD TAHAE+LAI+  CR L
Sbjct: 6   FLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRL 65

Query: 67  SQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSP 126
           + + L   +LYVTLEPC MC+ A+ L+RI ++ + A + K GG+ +        T +H  
Sbjct: 66  NTKYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRV 125

Query: 127 EIYPGISEQRSRQIIQDFFKERR 149
           +      E+ + +++ +FFK+ R
Sbjct: 126 KWEYYPLEE-ASELLSEFFKKLR 147


>d2a8na1 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]} Length = 130 Back     information, alignment and structure
>d2b3ja1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]} Length = 151 Back     information, alignment and structure
>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]} Length = 189 Back     information, alignment and structure
>d1wkqa_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]} Length = 158 Back     information, alignment and structure
>d1z3aa1 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1p6oa_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 156 Back     information, alignment and structure
>d2b3za2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Length = 145 Back     information, alignment and structure
>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Length = 147 Back     information, alignment and structure
>d1vq2a_ c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage T4 [TaxId: 10665]} Length = 193 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
d1wwra1151 tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 100.0
d2b3ja1151 tRNA adenosine deaminase TadA {Staphylococcus aureus [T 100.0
d1z3aa1156 tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 100.0
d2g84a1189 Putative deaminase NE0047 {Nitrosomonas europaea [TaxId 100.0
d2a8na1130 Cytidine and deoxycytidylate deaminase CodA {Agrobacter 100.0
d1wkqa_158 Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423] 100.0
d1p6oa_156 Cytosine deaminase {Baker's yeast (Saccharomyces cerevi 100.0
d2hxva2147 Riboflavin biosynthesis protein RibD {Thermotoga mariti 100.0
d2b3za2145 Riboflavin biosynthesis protein RibD {Bacillus subtilis 100.0
d1vq2a_193 Deoxycytidylate deaminase {Bacteriophage T4 [TaxId: 106 99.96
d2d30a1124 mono-domain cytidine deaminase {Bacillus anthracis [Tax 98.02
d1alna2144 Two-domain cytidine deaminase {Escherichia coli [TaxId: 97.86
d1r5ta_141 mono-domain cytidine deaminase {Baker's yeast (Saccharo 97.85
d2fr5a1136 mono-domain cytidine deaminase {Mouse (Mus musculus) [T 97.76
d1uwza_130 mono-domain cytidine deaminase {Bacillus subtilis [TaxI 97.73
d1alna1150 Two-domain cytidine deaminase {Escherichia coli [TaxId: 97.23
d2z3ga1123 Blasticidin-S deaminase {Aspergillus terreus [TaxId: 33 96.86
>d1wwra1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Cytidine deaminase-like
superfamily: Cytidine deaminase-like
family: Deoxycytidylate deaminase-like
domain: tRNA adenosine deaminase TadA
species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00  E-value=0  Score=319.47  Aligned_cols=146  Identities=39%  Similarity=0.604  Sum_probs=141.7

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             56999999999999887579980899998389099987347354488642511344566664148854541168861677
Q gi|255764464|r    3 KGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEP   82 (149)
Q Consensus         3 ~d~~~M~~A~~~A~~a~~~g~~PvGaviv~~g~ii~~g~N~~~~~~d~t~HAEi~ai~~a~~~~~~~~l~~~tlYtTlEP   82 (149)
                      +||+||++||++|++|+..|++|||||||++|+||+.|+|++.+..||++|||++||++|+++++..+|+++|||||+||
T Consensus         2 ~~e~fM~~Ai~~A~~a~~~~~~pVGaVIV~~~~ii~~g~n~~~~~~~~~~HAE~~ai~~a~~~~~~~~l~~~tlY~TlEP   81 (151)
T d1wwra1           2 GKEYFLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLNTKYLEGCELYVTLEP   81 (151)
T ss_dssp             SHHHHHHHHHHHHHHHHHTTSCCCEEEEEETTEEEEEEECCHHHHTCTTCCHHHHHHHHHHHHHTCSCCTTEEEEESSCC
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCC
T ss_conf             88999999999999875269999999999799566630332224675011389999999987538565578676500268


Q ss_pred             CHHHHHHHHHCCCCEEEEEECCCCCCEECCHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHC
Q ss_conf             6889899986088859997117988501741344431689999879928218999999899988409
Q gi|255764464|r   83 CTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR  149 (149)
Q Consensus        83 C~MC~~Ai~~agI~rVvyg~~d~~~g~~~~~~~~~~~~~~~~~~~v~~gvl~ee~~~Ll~~ff~~kR  149 (149)
                      |+||++||+|+||+|||||+.||+.|+.++..+++..+.++|+++|.+|++ +||.+||++||++||
T Consensus        82 C~mC~~ai~~~~I~rVvyg~~d~~~~~~~~~~~~~~~~~~~~~~~v~~~~~-ee~~~Ll~~Ff~~~R  147 (151)
T d1wwra1          82 CIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVKWEYYPL-EEASELLSEFFKKLR  147 (151)
T ss_dssp             BHHHHHHHHHTTCSEEEESSCCTTTBTTTTSCCGGGCTTCSSCCEEEECCC-HHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCEEEEECH-HHHHHHHHHHHHHHH
T ss_conf             827888999855885899845699875343888876421589988996039-999999999999972



>d2b3ja1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z3aa1 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2a8na1 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wkqa_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6oa_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b3za2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vq2a_ c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2d30a1 c.97.1.1 (A:1-124) mono-domain cytidine deaminase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1alna2 c.97.1.1 (A:151-294) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ta_ c.97.1.1 (A:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fr5a1 c.97.1.1 (A:11-146) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwza_ c.97.1.1 (A:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1alna1 c.97.1.1 (A:1-150) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z3ga1 c.97.1.1 (A:2-124) Blasticidin-S deaminase {Aspergillus terreus [TaxId: 33178]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 149 Cytidine/deoxycytidylate deaminase, zinc-binding r
1wwr_A_171 (A:) TRNA adenosine deaminase TADA; homodimer, rik 1e-26
1z3a_A_168 (A:) TRNA-specific adenosine deaminase; tRNA adeno 4e-26
2b3j_A_159 (A:) TRNA adenosine deaminase; mixed alpha-beta, p 2e-25
3dh1_A_189 (A:) TRNA-specific adenosine deaminase 2; zinc-bin 2e-24
2a8n_A_144 (A:) Cytidine and deoxycytidylate deaminase; RNA e 1e-23
2g84_A_197 (A:) Cytidine and deoxycytidylate deaminase zinc- 8e-23
2nx8_A_179 (A:) TRNA-specific adenosine deaminase; TAD, hydro 2e-22
2w4l_A_178 (A:) DCMP deaminse, deoxycytidylate deaminase; pyr 9e-22
1p6o_A_161 (A:) Cytosine deaminase; hydrolase, dimer, inhibit 8e-21
2hxv_A_1-154154 (A:1-154) Diaminohydroxyphosphoribosylaminopyrimid 3e-20
1vq2_A_1-45_102-193137 (A:1-45,A:102-193) DCMP deaminase, deoxycytidylate 3e-19
2hvw_A_184 (A:) Deoxycytidylate deaminase; 3-layer (alpha-bet 1e-17
2b3z_A_1-146146 (A:1-146) Riboflavin biosynthesis protein RIBD; al 3e-17
2g6v_A_1-162162 (A:1-162) Riboflavin biosynthesis protein RIBD; RI 2e-16
1wkq_A_1-110110 (A:1-110) Guanine deaminase; domain SWAP, the cyti 5e-19
>1wwr_A (A:) TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus}Length = 171 Back     alignment and structure
 Score =  113 bits (282), Expect = 1e-26
 Identities = 58/143 (40%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 7   FMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRIL 66
           F+  AL EA+ A  + E+PVGA+ V   +IIS+A N   ELKD TAHAE+LAI+  CR L
Sbjct: 26  FLKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRL 85

Query: 67  SQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSP 126
           + + L   +LYVTLEPC MC+ A+ L+RI ++ + A + K GG+ +        T +H  
Sbjct: 86  NTKYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRV 145

Query: 127 EIYPGISEQRSRQIIQDFFKERR 149
           +      E+ + +++ +FFK+ R
Sbjct: 146 KWEYYPLEE-ASELLSEFFKKLR 167


>1z3a_A (A:) TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli}Length = 168 Back     alignment and structure
>2b3j_A (A:) TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp}Length = 159 Back     alignment and structure
>3dh1_A (A:) TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens}Length = 189 Back     alignment and structure
>2a8n_A (A:) Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens}Length = 144 Back     alignment and structure
>2g84_A (A:) Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718}Length = 197 Back     alignment and structure
>2nx8_A (A:) TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6}Length = 179 Back     alignment and structure
>2w4l_A (A:) DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens}Length = 178 Back     alignment and structure
>1p6o_A (A:) Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae}Length = 161 Back     alignment and structure
>2hxv_A (A:1-154) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima}Length = 154 Back     alignment and structure
>1vq2_A (A:1-45,A:102-193) DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4}Length = 137 Back     alignment and structure
>2hvw_A (A:) Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A*Length = 184 Back     alignment and structure
>2b3z_A (A:1-146) Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis}Length = 146 Back     alignment and structure
>2g6v_A (A:1-162) Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A*Length = 162 Back     alignment and structure
>1wkq_A (A:1-110) Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis}Length = 110 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 Cytidine/deoxycytidylate deaminase, zinc-binding region
2b3j_A_159 TRNA adenosine deaminase; mixed alpha-beta, protei 100.0
2nx8_A_179 TRNA-specific adenosine deaminase; TAD, hydrolase; 100.0
1z3a_A_168 TRNA-specific adenosine deaminase; tRNA adenosine 100.0
2a8n_A_144 Cytidine and deoxycytidylate deaminase; RNA editin 100.0
1wwr_A_171 TRNA adenosine deaminase TADA; homodimer, riken st 100.0
3dh1_A_189 TRNA-specific adenosine deaminase 2; zinc-binding 100.0
2g84_A_197 Cytidine and deoxycytidylate deaminase zinc- bindi 100.0
2hxv_A_1-154154 Diaminohydroxyphosphoribosylaminopyrimidine deamin 100.0
1p6o_A_161 Cytosine deaminase; hydrolase, dimer, inhibitor bo 100.0
2g6v_A_1-162162 Riboflavin biosynthesis protein RIBD; RIBD APO str 100.0
2w4l_A_178 DCMP deaminse, deoxycytidylate deaminase; pyrimidi 100.0
2b3z_A_1-146146 Riboflavin biosynthesis protein RIBD; alpha/beta/a 100.0
1vq2_A_1-45_102-193137 DCMP deaminase, deoxycytidylate deaminase; hydrola 100.0
2hvw_A_184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sa 99.97
1wkq_A_1-110110 Guanine deaminase; domain SWAP, the cytidine deami 99.97
1ctt_A_1-173173 Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Es 97.83
1uwz_A_136 Cytidine deaminase; CDD, tetramer, zinc binding, p 97.77
3dmo_A_138 Cytidine deaminase; structural genomics, seattle s 97.77
1r5t_A_142 Cytidine deaminase; zinc dependent deaminase, RNA 97.65
3b8f_A_1-119119 Putative blasticidin S deaminase; cytidine deamina 97.61
2fr5_A_146 Cytidine deaminase; zinc, tetrahydrouridine, prote 97.6
2d30_A_141 Cytidine deaminase; purines, pyrimidines, nucleosi 97.58
1ctt_A_174-294121 Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Es 97.57
3g8q_A_1-114114 Predicted RNA-binding protein, contains thump doma 97.33
2z3g_A_130 Blasticidin-S deaminase; hydrolase, cytidine deami 97.24
2nyt_A_190 Probable C->U-editing enzyme apobec-2; cytidine de 95.38
3ir2_A_207 DNA DC->DU-editing enzyme apobec-3G; antiviral def 93.52
2bl9_A_ 238 Dihydrofolate reductase-thymidylate synthase; plam 95.12
>2b3j_A (A:) TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=297.16  Aligned_cols=149  Identities=37%  Similarity=0.615  Sum_probs=145.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             98569999999999998875799808999983890999873473544886425113445666641488545411688616
Q gi|255764464|r    1 MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTL   80 (149)
Q Consensus         1 M~~d~~~M~~A~~~A~~a~~~g~~PvGaviv~~g~ii~~g~N~~~~~~d~t~HAEi~ai~~a~~~~~~~~l~~~tlYtTl   80 (149)
                      |++|++||++|+++|+++...|+.|||||||++|+||+.|+|++....||+.|||+++++++....+..++++||||||+
T Consensus         4 ~~~de~~M~~a~~~A~~~~~~g~~pvGaviv~~g~ii~~g~N~~~~~~~~~~Hae~~a~~~a~~~~~~~~l~~~tly~T~   83 (159)
T 2b3j_A            4 MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTL   83 (159)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHTTSCCCEEEEEETTEEEEEEECCHHHHTCTTCCHHHHHHHHHHHHHTSSCCTTEEEEEEE
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
T ss_conf             76799999999999998541699988999984663100120210026874211467777899997288777786676524


Q ss_pred             CCCHHHHHHHHHCCCCEEEEEECCCCCCEECCHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHC
Q ss_conf             776889899986088859997117988501741344431689999879928218999999899988409
Q gi|255764464|r   81 EPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR  149 (149)
Q Consensus        81 EPC~MC~~Ai~~agI~rVvyg~~d~~~g~~~~~~~~~~~~~~~~~~~v~~gvl~ee~~~Ll~~ff~~kR  149 (149)
                      |||+||++||+|+||+||||+..+++.+..++...++....++|+++|++|++++||.+|+++||+++|
T Consensus        84 EPC~mC~~ai~~agI~rVvy~~~~~~~~~~~~~~~~~~~~~i~~~~~v~~gvl~~e~~~l~~~f~~~~~  152 (159)
T 2b3j_A           84 EPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLR  152 (159)
T ss_dssp             CCCHHHHHHHHHTTCSEEEEEECCTTTCTBTTSCBTTSCTTSSCCCEEECCTTHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             751667889986145648997227998755738899885799999679868199999999999999998



>2nx8_A (A:) TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6} Back     alignment and structure
>1z3a_A (A:) TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli} Back     alignment and structure
>2a8n_A (A:) Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>1wwr_A (A:) TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3dh1_A (A:) TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2g84_A (A:) Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2hxv_A (A:1-154) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} Back     alignment and structure
>1p6o_A (A:) Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae} Back     alignment and structure
>2g6v_A (A:1-162) Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2w4l_A (A:) DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2b3z_A (A:1-146) Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} Back     alignment and structure
>1vq2_A (A:1-45,A:102-193) DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4} Back     alignment and structure
>2hvw_A (A:) Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Back     alignment and structure
>1wkq_A (A:1-110) Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis} Back     alignment and structure
>1ctt_A (A:1-173) Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escherichia coli} Back     alignment and structure
>1uwz_A (A:) Cytidine deaminase; CDD, tetramer, zinc binding, pyrimidine metabolism, salvage, hydrolase; HET: THU; 1.99A {Bacillus subtilis} Back     alignment and structure
>3dmo_A (A:) Cytidine deaminase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1r5t_A (A:) Cytidine deaminase; zinc dependent deaminase, RNA editing, apobec-1 related protein, hydrolase; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3b8f_A (A:1-119) Putative blasticidin S deaminase; cytidine deaminase, structural genomics, PSI-2, MCSG, protein structure initiative; 1.90A {Bacillus anthracis} Back     alignment and structure
>2fr5_A (A:) Cytidine deaminase; zinc, tetrahydrouridine, protein- inhibitor complex, alternate conformation of Arg68, hydrolase; HET: TYU; 1.48A {Mus musculus} Back     alignment and structure
>2d30_A (A:) Cytidine deaminase; purines, pyrimidines, nucleosides, nucleotides, salvage of nucleosides and nucleotides, structural genomics; 2.40A {Bacillus anthracis} Back     alignment and structure
>1ctt_A (A:174-294) Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escherichia coli} Back     alignment and structure
>3g8q_A (A:1-114) Predicted RNA-binding protein, contains thump domain; cytidine deaminase, ferredoxin-like domain; 2.40A {Methanopyrus kandleri} Back     alignment and structure
>2z3g_A (A:) Blasticidin-S deaminase; hydrolase, cytidine deaminase family, zinc, tetramer; HET: TRE; 1.50A {Aspergillus terreus} Back     alignment and structure
>2nyt_A (A:) Probable C->U-editing enzyme apobec-2; cytidine deaminase, zinc-ION binding, hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>3ir2_A (A:) DNA DC->DU-editing enzyme apobec-3G; antiviral defense, HOST-virus interaction, hydrolase, metal-binding, X-RAY, zinc, alternative splicing; HET: DNA; 2.25A {Homo sapiens} PDB: 2kem_A* 2jyw_A* 2kbo_A* 3e1u_A* 3iqs_A* Back     alignment and structure
>2bl9_A (A:) Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Back     alignment and structure