254780359

254780359

GTP cyclohydrolase II protein (riboflavin biosynthesis)

GeneID in NCBI database:8209344Locus tag:CLIBASIA_01220
Protein GI in NCBI database:254780359Protein Accession:YP_003064772.1
Gene range:+(256428, 257060)Protein Length:210aa
Gene description:GTP cyclohydrolase II protein (riboflavin biosynthesis)
COG prediction:[H] 3,4-dihydroxy-2-butanone 4-phosphate synthase
KEGG prediction:GTP cyclohydrolase II protein (riboflavin biosynthesis); K01497 GTP cyclohydrolase II [EC:3.5.4.25] K02858 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
SEED prediction:3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25)
Pathway involved in KEGG:Riboflavin metabolism [PATH:las00740]
Subsystem involved in SEED:Riboflavin, FMN and FAD metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
ccccccccHHHHHHHHHHHHcccEEEEEEcccccccccEEEEHHHccHHHHHHHHHHcccEEEEEccHHHHHHccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHcccccHHHccccccEEEEEcccccEEEcccccHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHcccEEEHHHHHHHHHHccc
ccccHHcccccHHHHHHHHHccccEEEEccccccccEEEEEEHHHccHHHHHHHHHHEccccEEEEcHHHHHHccccEccccccccccccEEccEEEcccccccccHHHHHHHHHHHHcccccHHHEEEEEEEEEEEccccHHHccccHHHHHHHHHHHcccccEEEEEEEEEccccccccHHHHHHHHHccccEEEHHHHHHHHHHccc
mkqkksldERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTcgivctpmpfhtahklklnpmvlenesvhktaftvsvdskhgittgisadDRAYTIknlanphsiadnfvrpghifplisrdggvlvrpghteasvdlckitglppIAVICELvnddgtikkGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
mkqkkslderyIEDViqsfqkgeMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAftvsvdskhgittgisaDDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQViefskkydlkiisvqdliawrkkkei
MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
***********IEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKK***
********ERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
****KSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI
MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
254781107 542 phosphoglucomutase [Candidatus Liberibacter asiati 0.031
>gi|254781107|ref|YP_003065520.1| phosphoglucomutase [Candidatus Liberibacter asiaticus str. psy62] Length = 542 Back     alignment
 Score = 30.0 bits (66), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 44/109 (40%), Gaps = 1/109 (0%)

Query: 3   QKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIH-CTSEKMAFIIRHTCGI 61
           Q+ S  E +I+ +  +    E  +V   D R     ++   I    +   A II    GI
Sbjct: 29  QQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGI 88

Query: 62  VCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDR 110
           + TP   H   K K +  ++   S +    T     K+  ++G SA ++
Sbjct: 89  LSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQ 137

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
315122180210 GTP cyclohydrolase II protein (riboflavin biosynthesis) 1 4e-97
190890651 367 GTP cyclohydrolase II protein (riboflavin biosynthesis) 1 5e-77
116250779 367 riboflavin biosynthesis protein [Rhizobium leguminosaru 1 7e-77
241203373 367 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rhizobiu 1 8e-77
209548191 367 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rhizobiu 1 8e-77
325292136 366 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclo 1 1e-76
222085105 367 GTP cyclohydrolase II protein [Agrobacterium radiobacte 1 1e-76
227821100 366 riboflavin biosynthesis protein [Sinorhizobium fredii N 1 2e-76
110633088 368 GTP cyclohydrolase II [Mesorhizobium sp. BNC1] Length = 1 3e-76
15888096 366 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP cycloh 1 3e-76
>gi|315122180|ref|YP_004062669.1| GTP cyclohydrolase II protein (riboflavin biosynthesis) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 210 Back     alignment and organism information
 Score =  358 bits (918), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%)

Query: 1   MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCG 60
           M+QK  L+E++I +VIQ+FQKG MVIVTD DDRENEADLVL AIHCTS+KMAFIIRHTCG
Sbjct: 1   MEQKMPLNEQHISNVIQNFQKGNMVIVTDEDDRENEADLVLPAIHCTSDKMAFIIRHTCG 60

Query: 61  IVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANP 120
           IVCTPMP   A KL LNPMVLENESVHKTAFTVSVDSKHGITTGIS+ DR +T+KNL NP
Sbjct: 61  IVCTPMPSQNARKLGLNPMVLENESVHKTAFTVSVDSKHGITTGISSADRTHTVKNLTNP 120

Query: 121 HSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKK 180
            S A++FVRPGHIFPLISRDGGVL+RPGHTEASVDLCKI GLP +AVICELVNDDGTIKK
Sbjct: 121 QSTANDFVRPGHIFPLISRDGGVLIRPGHTEASVDLCKIAGLPQVAVICELVNDDGTIKK 180

Query: 181 GKQVIEFSKKYDLKIISVQDLIAWRKKKEI 210
           GKQVIEFS K+ LKIIS++DLIAWR++K++
Sbjct: 181 GKQVIEFSIKHGLKIISIKDLIAWRQQKKV 210


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890651|ref|YP_001977193.1| GTP cyclohydrolase II protein (riboflavin biosynthesis) [Rhizobium etli CIAT 652] Length = 367 Back     alignment and organism information
>gi|116250779|ref|YP_766617.1| riboflavin biosynthesis protein [Rhizobium leguminosarum bv. viciae 3841] Length = 367 Back     alignment and organism information
>gi|241203373|ref|YP_002974469.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 367 Back     alignment and organism information
>gi|209548191|ref|YP_002280108.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 367 Back     alignment and organism information
>gi|325292136|ref|YP_004278000.1| 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II [Agrobacterium sp. H13-3] Length = 366 Back     alignment and organism information
>gi|222085105|ref|YP_002543635.1| GTP cyclohydrolase II protein [Agrobacterium radiobacter K84] Length = 367 Back     alignment and organism information
>gi|227821100|ref|YP_002825070.1| riboflavin biosynthesis protein [Sinorhizobium fredii NGR234] Length = 366 Back     alignment and organism information
>gi|110633088|ref|YP_673296.1| GTP cyclohydrolase II [Mesorhizobium sp. BNC1] Length = 368 Back     alignment and organism information
>gi|15888096|ref|NP_353777.1| 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP cyclohydrolase II [Agrobacterium tumefaciens str. C58] Length = 366 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
PRK09311 402 PRK09311, PRK09311, bifunctional 3,4-dihydroxy-2-butano 5e-78
COG0108203 COG0108, RibB, 3,4-dihydroxy-2-butanone 4-phosphate syn 4e-73
PRK09314 339 PRK09314, PRK09314, bifunctional 3,4-dihydroxy-2-butano 2e-70
PLN02831 450 PLN02831, PLN02831, Bifunctional GTP cyclohydrolase II/ 1e-69
PRK03353217 PRK03353, ribB, 3,4-dihydroxy-2-butanone 4-phosphate sy 8e-63
TIGR00506199 TIGR00506, ribB, 3,4-dihydroxy-2-butanone 4-phosphate s 3e-62
PRK14019 367 PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butano 1e-61
PRK00910218 PRK00910, ribB, 3,4-dihydroxy-2-butanone 4-phosphate sy 1e-55
PRK01792214 PRK01792, ribB, 3,4-dihydroxy-2-butanone 4-phosphate sy 7e-53
PRK12485 369 PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-butano 2e-52
PRK09319 555 PRK09319, PRK09319, bifunctional 3,4-dihydroxy-2-butano 2e-51
PRK00014230 PRK00014, ribB, 3,4-dihydroxy-2-butanone 4-phosphate sy 2e-46
KOG1284357 KOG1284, KOG1284, KOG1284, Bifunctional GTP cyclohydrol 4e-43
PRK09318 387 PRK09318, PRK09318, bifunctional 3,4-dihydroxy-2-butano 1e-26
PRK05773219 PRK05773, PRK05773, 3,4-dihydroxy-2-butanone 4-phosphat 7e-16
pfam00926193 pfam00926, DHBP_synthase, 3,4-dihydroxy-2-butanone 4-ph 2e-81
>gnl|CDD|181774 PRK09311, PRK09311, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|30457 COG0108, RibB, 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181775 PRK09314, PRK09314, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|178425 PLN02831, PLN02831, Bifunctional GTP cyclohydrolase II/ 3,4-dihydroxy-2-butanone-4-phosphate synthase Back     alignment and domain information
>gnl|CDD|179565 PRK03353, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|161903 TIGR00506, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information
>gnl|CDD|184457 PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179162 PRK00910, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|167278 PRK01792, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|171535 PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>gnl|CDD|181777 PRK09319, PRK09319, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|134031 PRK00014, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|36498 KOG1284, KOG1284, KOG1284, Bifunctional GTP cyclohydrolase II/3,4-dihydroxy-2butanone-4-phosphate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|181776 PRK09318, PRK09318, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|180250 PRK05773, PRK05773, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated Back     alignment and domain information
>gnl|CDD|144503 pfam00926, DHBP_synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
PRK12485 369 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synth 100.0
PRK09311 400 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synth 100.0
PRK09319 552 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synth 100.0
PRK09314 339 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synth 100.0
TIGR00506230 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Int 100.0
PRK00910218 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Pro 100.0
PRK00014230 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Pro 100.0
COG0108203 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coe 100.0
PRK03353217 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Pro 100.0
PRK01792214 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Pro 100.0
PRK09318 387 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synth 100.0
pfam00926193 DHBP_synthase 3,4-dihydroxy-2-butanone 4-phosphate synt 100.0
PRK05773218 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validate 100.0
KOG1284357 consensus 100.0
PRK08815 376 GTP cyclohydrolase; Provisional 100.0
KOG3009 614 consensus 91.63
TIGR00644 705 recJ single-stranded-DNA-specific exonuclease RecJ; Int 93.05
>PRK12485 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>PRK09311 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>PRK09319 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>PRK09314 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>TIGR00506 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; InterPro: IPR000422 3,4-Dihydroxy-2-butanone 4-phosphate is biosynthesized from ribulose 5-phosphate and serves as the biosynthetic precursor for the xylene ring of riboflavin Back     alignment and domain information
>PRK00910 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK00014 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>COG0108 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK03353 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK01792 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK09318 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>pfam00926 DHBP_synthase 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information
>PRK05773 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated Back     alignment and domain information
>KOG1284 consensus Back     alignment and domain information
>PRK08815 GTP cyclohydrolase; Provisional Back     alignment and domain information
>KOG3009 consensus Back     alignment and domain information
>TIGR00644 recJ single-stranded-DNA-specific exonuclease RecJ; InterPro: IPR004610 All proteins in this family are 5'-3' single-strand DNA exonucleases Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
3mk5_A212 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 3e-60
3mgz_A206 Crystal Structure Of Dhbps Domain Of Bi-Functional 6e-60
1iez_A217 Solution Structure Of 3,4-Dihydroxy-2-Butanone 4-Ph 4e-59
1g57_A217 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 5e-59
3lqu_A217 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 2e-58
1tks_A204 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 6e-57
3h07_A220 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 6e-57
1k49_A233 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 8e-50
1pvw_A227 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From 6e-38
1pvy_A227 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From 1e-37
>gi|323714477|pdb|3MK5|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Domain From Mycobacterium Tuberculosis With Sulfate And Zinc At Ph 4.00 Length = 212 Back     alignment and structure
 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 137/203 (67%), Gaps = 2/203 (0%)

Query: 9   ERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPF 68
              +E  +     G+ VIV D +DRENE DL+ AA   T E +AF++R+T G +C P+  
Sbjct: 10  LDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG 69

Query: 69  HTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFV 128
               +L L PM   N+  H TA+TV+VD+++GI TGISA DRA T++ LA+P S+AD+F 
Sbjct: 70  AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFT 129

Query: 129 RPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVN--DDGTIKKGKQVIE 186
           RPGH+ PL ++DGGVL RPGHTEA+VDL ++ GL P   ICE+V+  D+G++    ++  
Sbjct: 130 RPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRV 189

Query: 187 FSKKYDLKIISVQDLIAWRKKKE 209
           F+ ++ L +I++ DLI WR+K E
Sbjct: 190 FADEHGLALITIADLIEWRRKHE 212


>gi|323714464|pdb|3MGZ|A Chain A, Crystal Structure Of Dhbps Domain Of Bi-Functional DhbpsGTP Cyclohydrolase Ii From Mycobacterium Tuberculosis At Ph 4.0 Length = 206 Back     alignment and structure
gi|16974815|pdb|1IEZ|A Chain A, Solution Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Of Riboflavin Biosynthesis Length = 217 Back     alignment and structure
>gi|14278251|pdb|1G57|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Length = 217 Back     alignment and structure
gi|306991664|pdb|3LQU|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Complexed With Ribulose-5 Phosphate Length = 217 Back     alignment and structure
gi|55669967|pdb|1TKS|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Of Candida Albicans Length = 204 Back     alignment and structure
>gi|229597959|pdb|3H07|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From Yersinia Pestis Co92 Length = 220 Back     alignment and structure
gi|20150651|pdb|1K49|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase (Cation Free Form) Length = 233 Back     alignment and structure
gi|38492855|pdb|1PVW|A Chain A, 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From M. Jannaschii Length = 227 Back     alignment and structure
>gi|38492858|pdb|1PVY|A Chain A, 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From M. Jannaschii In Complex With Ribulose 5-Phosphate Length = 227 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
1g57_A217 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate syn 4e-65
1k4i_A233 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflav 4e-64
1snn_A227 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate syn 1e-56
1tks_A204 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflav 3e-51
>1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} SCOP: d.115.1.2 PDB: 1g58_A 1iez_A 3h07_A Length = 217 Back     alignment and structure
 Score =  242 bits (619), Expect = 4e-65
 Identities = 81/198 (40%), Positives = 127/198 (64%)

Query: 12  IEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTA 71
           +E+ + + ++G  V+V D +DRENE D++  A   T E+MA  IRH  GIVC  +     
Sbjct: 16  VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRR 75

Query: 72  HKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPG 131
            +L L  MV  N S + T FTV++++  G+TTG+SA DR  T++      +   +  RPG
Sbjct: 76  KQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPG 135

Query: 132 HIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKY 191
           H+FPL ++ GGVL R GHTEA++DL  + G  P  V+CEL NDDGT+ +  + IEF+ K+
Sbjct: 136 HVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKH 195

Query: 192 DLKIISVQDLIAWRKKKE 209
           ++ +++++DL+A+R+  E
Sbjct: 196 NMALVTIEDLVAYRQAHE 213


>1k4i_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} SCOP: d.115.1.2 PDB: 1k49_A 1k4l_A 1k4o_A 1k4p_A Length = 233 Back     alignment and structure
>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} SCOP: d.115.1.2 PDB: 1pvy_A* 1pvw_A Length = 227 Back     alignment and structure
>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} SCOP: d.115.1.2 PDB: 1tku_A* 2ris_A 2riu_A* Length = 204 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
1g57_A217 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate syn 100.0
1snn_A227 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate syn 100.0
1k4i_A233 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflav 100.0
1tks_A204 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflav 100.0
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 90.75
>1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} SCOP: d.115.1.2 PDB: 1g58_A 1iez_A 3h07_A Back     alignment and structure
Probab=100.00  E-value=0  Score=536.90  Aligned_cols=204  Identities=40%  Similarity=0.701  Sum_probs=200.8

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCCCCC
Q ss_conf             77956699999999689829999677898870133484459999999999708994586146899987403643244566
Q gi|254780359|r    6 SLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENES   85 (210)
Q Consensus         6 ~~~~~~ie~ai~al~~G~~Viv~D~~dREnEgDlv~~Ae~vt~e~i~fm~~~~~Glic~al~~~~~~~L~Lp~m~~~n~~   85 (210)
                      ...|++|++||++||+|+||||+||+|||||||||++|+++||++|+||++|++|+||+|+++++|++|+||+|+..|.+
T Consensus        10 ~~~~~~i~~ai~al~~G~~Viv~Dd~dRE~EgDlv~aAe~iT~e~i~fm~~~~~GliC~a~~~~~~~~L~Lp~m~~~~~~   89 (217)
T 1g57_A           10 GTPFERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTS   89 (217)
T ss_dssp             CCHHHHHHHHHHHHHTTCCEEEEC----CCCEEEEEETTTCCHHHHHHHHHHBCSCCEEEECHHHHHHTTCCBSCSSCCC
T ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEECCCHHHHHHCCCCCCCCCCCC
T ss_conf             89600599999999879979998689988751789785759999999999948988897278999953699973555667


Q ss_pred             CCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCCE
Q ss_conf             56652178872034777899988999999999842013243138985001001269824667802677699887699600
Q gi|254780359|r   86 VHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPI  165 (210)
Q Consensus        86 ~~~taFtvsvd~~~g~tTGISa~DRa~TIr~la~~~~~~~df~~PGHV~pL~a~~gGvl~R~GHTEaavdL~~lAGl~P~  165 (210)
                      .++++||+||||++|++|||||+||++||+.|++++++|+||++|||||||++++|||++|+|||||+||||+|||++|+
T Consensus        90 ~~~~~ftvsVd~~~g~tTGISa~DRa~Ti~~l~~~~~~~~df~~PGHV~pL~a~~gGvl~R~GHTEaavdL~~lAGl~P~  169 (217)
T 1g57_A           90 AYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPA  169 (217)
T ss_dssp             TTCCCBBSCEEESSSCSSSCSHHHHHHHHHHHHSTTCCGGGEEEEEEEEEEECCTTGGGTCCSHHHHHHHHHHHTTSCSC
T ss_pred             CCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             78885068874267866897999999999987547999465379994486235679806789689899999998199983


Q ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEHHHHHHHHHHCC
Q ss_conf             59888536887505989999999983890777999999998437
Q gi|254780359|r  166 AVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKE  209 (210)
Q Consensus       166 ~vi~Eil~~~G~~~~~~~~~~fA~~~~lp~i~i~dli~yr~~~e  209 (210)
                      +||||||+++|+||+++++++||++|+||+|+|+|||+||+++|
T Consensus       170 avi~Eil~~~G~~~~~~~~~~fA~~~~l~~isi~dli~yR~~~e  213 (217)
T 1g57_A          170 GVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE  213 (217)
T ss_dssp             EEEEEBBCTTSSBCCHHHHHHHHHHTTCEEEEHHHHHHHHHHHC
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHHHC
T ss_conf             89999855998726889999999983997998999999999835



>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} SCOP: d.115.1.2 PDB: 1pvy_A* 1pvw_A Back     alignment and structure
>1k4i_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} SCOP: d.115.1.2 PDB: 1k49_A 1k4l_A 1k4o_A 1k4p_A Back     alignment and structure
>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} SCOP: d.115.1.2 PDB: 1tku_A* 2ris_A 2riu_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
d1snna_219 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate syn 1e-55
d1g57a_209 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate syn 4e-54
d1k4ia_216 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate syn 8e-53
d1tksa_202 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate syn 2e-52
>d1snna_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 219 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: YrdC/RibB
superfamily: YrdC/RibB
family: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
domain: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
species: Archaeon Methanocaldococcus jannaschii [TaxId: 2190]
 Score =  209 bits (534), Expect = 1e-55
 Identities = 63/217 (29%), Positives = 114/217 (52%), Gaps = 25/217 (11%)

Query: 12  IEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTA 71
           +E  I++ +KGE+++V D+D+RE E D+V+A+   T E +  + +   G++CT +     
Sbjct: 3   VEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDIC 62

Query: 72  HKLKLNPMVLENESV------------------HKTAFTVSVDSKHGITTGISADDRAYT 113
           +KL +  MV   E                     K++F+++++ +    TGI+ +DRA+T
Sbjct: 63  NKLGIPFMVDILEFASQKFKVLRELYPNDIPYDEKSSFSITINHRKT-FTGITDNDRAFT 121

Query: 114 IKNLAN------PHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAV 167
           IK LA        +     F  PG +  L + +G V  R GHTE +V L ++  L PI  
Sbjct: 122 IKKLAELVKEGRFNDFGKEFRSPGSVTLLRAAEGLVKNRQGHTEMTVALAELANLVPITT 181

Query: 168 ICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAW 204
           ICE++ DDG      +   +++K++L  +S +++I +
Sbjct: 182 ICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEIINY 218


>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure
>d1k4ia_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea [TaxId: 148305]} Length = 216 Back     information, alignment and structure
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]} Length = 202 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
d1g57a_209 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP syn 100.0
d1tksa_202 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP syn 100.0
d1k4ia_216 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP syn 100.0
d1snna_219 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP syn 100.0
>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: YrdC/RibB
superfamily: YrdC/RibB
family: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
domain: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=538.01  Aligned_cols=207  Identities=39%  Similarity=0.686  Sum_probs=202.5

Q ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCC
Q ss_conf             77577956699999999689829999677898870133484459999999999708994586146899987403643244
Q gi|254780359|r    3 QKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLE   82 (210)
Q Consensus         3 ~~~~~~~~~ie~ai~al~~G~~Viv~D~~dREnEgDlv~~Ae~vt~e~i~fm~~~~~Glic~al~~~~~~~L~Lp~m~~~   82 (210)
                      ......|++|++||++||+|+||||+||++||||||||++|+++||++|+||++|++|+||+|+++++|++|+||+|+..
T Consensus         3 ~~~~~~~~~ie~ai~alk~G~~Viv~Dd~~RE~EgDlv~~Ae~~t~e~i~fm~~~~~GliC~a~~~~~~~~L~Lp~m~~~   82 (209)
T d1g57a_           3 SSFGTPFERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMMVEN   82 (209)
T ss_dssp             GGGCCHHHHHHHHHHHHHTTCCEEEEC----CCCEEEEEETTTCCHHHHHHHHHHBCSCCEEEECHHHHHHTTCCBSCSS
T ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEECCCHHHHHCCCCCCCCCC
T ss_conf             32178520499999999879979999789988742689897989999999999838998787356999850799986665


Q ss_pred             CCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             56656652178872034777899988999999999842013243138985001001269824667802677699887699
Q gi|254780359|r   83 NESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGL  162 (210)
Q Consensus        83 n~~~~~taFtvsvd~~~g~tTGISa~DRa~TIr~la~~~~~~~df~~PGHV~pL~a~~gGvl~R~GHTEaavdL~~lAGl  162 (210)
                      |.+.++++|++|||+++|++|||||.|||+|||.|++++++|+||++|||||||++++|||++|+|||||+||||+|||+
T Consensus        83 ~~~~~~~~ftvsvd~~~g~tTGISa~dRa~Tir~l~~~~~~~~df~~PGHv~pL~a~~gGv~~R~GHTEaavdL~~lAGl  162 (209)
T d1g57a_          83 NTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGF  162 (209)
T ss_dssp             CCCTTCCCBBSCEEESSSCSSSCSHHHHHHHHHHHHSTTCCGGGEEEEEEEEEEECCTTGGGTCCSHHHHHHHHHHHTTS
T ss_pred             CCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCHHHHCCCCEECEEEECCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             54446876158998068854662699999999875233799889527730022654168845663088999999986599


Q ss_pred             CCEEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEHHHHHHHHHHCC
Q ss_conf             60059888536887505989999999983890777999999998437
Q gi|254780359|r  163 PPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKE  209 (210)
Q Consensus       163 ~P~~vi~Eil~~~G~~~~~~~~~~fA~~~~lp~i~i~dli~yr~~~e  209 (210)
                      +|++||||||+++|+||+.+++++||++|+||+++|+|||+||+++|
T Consensus       163 ~P~avi~Eil~~dG~~~~~~~~~~fA~~~~l~~isi~dli~yr~~~e  209 (209)
T d1g57a_         163 KPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE  209 (209)
T ss_dssp             CSCEEEEEBBCTTSSBCCHHHHHHHHHHTTCEEEEHHHHHHHHHHHC
T ss_pred             CCEEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHHCC
T ss_conf             97078999855998646889999999984997998999999998549



>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1k4ia_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea [TaxId: 148305]} Back     information, alignment and structure
>d1snna_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 210 GTP cyclohydrolase II protein (riboflavin biosynth
1g57_A_217 (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-pho 2e-70
1tks_A_204 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase 4e-70
1k4i_A_233 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase 7e-70
1snn_A_227 (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-pho 7e-68
>1g57_A (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli}Length = 217 Back     alignment and structure
 Score =  259 bits (663), Expect = 2e-70
 Identities = 81/198 (40%), Positives = 127/198 (64%)

Query: 12  IEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTA 71
           +E+ + + ++G  V+V D +DRENE D++  A   T E+MA  IRH  GIVC  +     
Sbjct: 16  VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRR 75

Query: 72  HKLKLNPMVLENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLANPHSIADNFVRPG 131
            +L L  MV  N S + T FTV++++  G+TTG+SA DR  T++      +   +  RPG
Sbjct: 76  KQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPG 135

Query: 132 HIFPLISRDGGVLVRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKY 191
           H+FPL ++ GGVL R GHTEA++DL  + G  P  V+CEL NDDGT+ +  + IEF+ K+
Sbjct: 136 HVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKH 195

Query: 192 DLKIISVQDLIAWRKKKE 209
           ++ +++++DL+A+R+  E
Sbjct: 196 NMALVTIEDLVAYRQAHE 213


>1tks_A (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314}Length = 204 Back     alignment and structure
>1k4i_A (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea}Length = 233 Back     alignment and structure
>1snn_A (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii}Length = 227 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 GTP cyclohydrolase II protein (riboflavin biosynthesis)
1snn_A_227 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 100.0
1g57_A_217 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 100.0
1k4i_A_233 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 100.0
1tks_A_204 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 100.0
>1snn_A (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=100.00  E-value=0  Score=531.19  Aligned_cols=201  Identities=31%  Similarity=0.554  Sum_probs=195.2

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCC-------
Q ss_conf             5669999999968982999967789887013348445999999999970899458614689998740364324-------
Q gi|254780359|r    9 ERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIHCTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVL-------   81 (210)
Q Consensus         9 ~~~ie~ai~al~~G~~Viv~D~~dREnEgDlv~~Ae~vt~e~i~fm~~~~~Glic~al~~~~~~~L~Lp~m~~-------   81 (210)
                      +++|++||++||+|+||||+|+++||||||||++|+++||++|+||++|++|+||+++++++|++|+||+|+.       
T Consensus         1 ~~~ie~ai~al~~G~~Viv~D~~~RE~Egdlv~~Ae~~T~e~i~fm~~~a~GliC~a~~~~~a~~L~Lp~m~~~~~~~~~   80 (227)
T 1snn_A            1 MNNVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNKLGIPFMVDILEFASQ   80 (227)
T ss_dssp             -CHHHHHHHHHHTTCCEEEECCTTTTCCEEEEEEGGGCCHHHHHHHHHHTEEEEEEEECHHHHHHHTCCCHHHHHHHHTT
T ss_pred             CCCHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEECCCHHHHHHCCCCCCCCCCCCCCC
T ss_conf             96399999999879979998589987651489885659999999999957998774589999987699511230000111


Q ss_pred             -----------CCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHH------HHCCHHHHCCCCCCCEEEECCCCCC
Q ss_conf             -----------45665665217887203477789998899999999984------2013243138985001001269824
Q gi|254780359|r   82 -----------ENESVHKTAFTVSVDSKHGITTGISADDRAYTIKNLAN------PHSIADNFVRPGHIFPLISRDGGVL  144 (210)
Q Consensus        82 -----------~n~~~~~taFtvsvd~~~g~tTGISa~DRa~TIr~la~------~~~~~~df~~PGHV~pL~a~~gGvl  144 (210)
                                 .|+..++++|||||||+ +++|||||+|||+|||.|++      ++++|+||++|||||||++++|||+
T Consensus        81 ~~~~~~~~~~~~~~~~~~t~FtvsVd~~-~~~TGISa~DRa~Tir~la~~~~~~~~~~~~~df~~PGHV~pL~a~~gGvl  159 (227)
T 1snn_A           81 KFKVLRELYPNDIPYDEKSSFSITINHR-KTFTGITDNDRAFTIKKLAELVKEGRFNDFGKEFRSPGSVTLLRAAEGLVK  159 (227)
T ss_dssp             TCHHHHHTCCTTCTTSSSCCEEEEEEET-TCSSSCSHHHHHHHHHHHHHHHHTTCGGGHHHHEEEEEEEEEEECCTTGGG
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEECC-CCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCEECCCEEECCCCC
T ss_conf             2332123445677666774169987046-776897606788899998731122486545344058860135035037734


Q ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEHHHHHHHHHHCCC
Q ss_conf             667802677699887699600598885368875059899999999838907779999999984379
Q gi|254780359|r  145 VRPGHTEASVDLCKITGLPPIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI  210 (210)
Q Consensus       145 ~R~GHTEaavdL~~lAGl~P~~vi~Eil~~~G~~~~~~~~~~fA~~~~lp~i~i~dli~yr~~~ei  210 (210)
                      +|+||||||||||+||||+|++|||||||++|+||+++++++||++|+||+++|+|||+||+++|+
T Consensus       160 ~R~GhTEasvdL~~lAGl~p~~vi~eil~~~G~~~~~~~~~~fA~~h~l~~isi~dli~yr~~~e~  225 (227)
T 1snn_A          160 NRQGHTEMTVALAELANLVPITTICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEIINYYLDKYL  225 (227)
T ss_dssp             TCCSHHHHHHHHHHHTTSCSEEEEEEEBCTTSSBCCHHHHHHHHHHHTCCEEEHHHHHHHC-----
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHHHHH
T ss_conf             666378899999974699744999999679987458899999999849978989999999998761



>1g57_A (A:) DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} Back     alignment and structure
>1k4i_A (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} Back     alignment and structure
>1tks_A (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} Back     alignment and structure