254780361

254780361

ribosomal protein L32

GeneID in NCBI database:8209346Locus tag:CLIBASIA_01230
Protein GI in NCBI database:254780361Protein Accession:YP_003064774.1
Gene range:-(258969, 259154)Protein Length:61aa
Gene description:ribosomal protein L32
COG prediction:[J] Ribosomal protein L32
KEGG prediction:ribosomal protein L32; K02911 large subunit ribosomal protein L32
SEED prediction:LSU ribosomal protein L32p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60-
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE
cccccccccHHHcccHHHHHHccccccEEccccccccccEEEcccccccccEEEEEccccc
ccccccccccccccccccHHHcccccccccccccccccccccccccccccccEEEEEcccc
mavpkrktspskrgmrrsadaltppayvedkksgelrrphhvdmktglyrgRQVFVLKTKE
mavpkrktspskrgmrrsadaltppayvedkksgelrrphhvdmktglyrgrqvfvlktke
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE
*AVP*RK*************ALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQ*FV*****
*********************LTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE
************************PAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLK***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooo
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE
MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
31512217861 ribosomal protein L32 [Candidatus Liberibacter solanace 1 4e-24
16385287962 ribosomal protein L32 [Methylobacterium extorquens PA1] 1 9e-21
17074338061 50S ribosomal protein L32 [Methylobacterium sp. 4-46] L 1 1e-20
25606180459 ribosomal protein L32 [Brucella neotomae 5K33] Length = 1 3e-20
8635959461 50S ribosomal protein L32 [Rhizobium etli CFN 42] Lengt 1 3e-20
11063575460 50S ribosomal protein L32 [Mesorhizobium sp. BNC1] Leng 1 3e-20
1596701761 50S ribosomal protein L32 [Sinorhizobium meliloti 1021] 1 3e-20
327191783131 50S ribosomal protein L32 [Rhizobium etli CNPAF512] Len 1 3e-20
15039831361 50S ribosomal protein L32 [Sinorhizobium medicae WSM419 1 3e-20
16386917659 50S ribosomal protein L32 [Bartonella tribocorum CIP 10 1 3e-20
>gi|315122178|ref|YP_004062667.1| ribosomal protein L32 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 61 Back     alignment and organism information
 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK 60
          MAVPKRKTSPSKRGMRRSADAL P +YVEDKKSGELRRPHHVDMKTG+YRGRQVFV+K K
Sbjct: 1  MAVPKRKTSPSKRGMRRSADALPPSSYVEDKKSGELRRPHHVDMKTGMYRGRQVFVVKNK 60

Query: 61 E 61
          E
Sbjct: 61 E 61


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163852879|ref|YP_001640922.1| ribosomal protein L32 [Methylobacterium extorquens PA1] Length = 62 Back     alignment and organism information
>gi|170743380|ref|YP_001772035.1| 50S ribosomal protein L32 [Methylobacterium sp. 4-46] Length = 61 Back     alignment and organism information
>gi|256061804|ref|ZP_05451939.1| ribosomal protein L32 [Brucella neotomae 5K33] Length = 59 Back     alignment and organism information
>gi|86359594|ref|YP_471486.1| 50S ribosomal protein L32 [Rhizobium etli CFN 42] Length = 61 Back     alignment and organism information
>gi|110635754|ref|YP_675962.1| 50S ribosomal protein L32 [Mesorhizobium sp. BNC1] Length = 60 Back     alignment and organism information
>gi|15967017|ref|NP_387370.1| 50S ribosomal protein L32 [Sinorhizobium meliloti 1021] Length = 61 Back     alignment and organism information
>gi|327191783|gb|EGE58785.1| 50S ribosomal protein L32 [Rhizobium etli CNPAF512] Length = 131 Back     alignment and organism information
>gi|150398313|ref|YP_001328780.1| 50S ribosomal protein L32 [Sinorhizobium medicae WSM419] Length = 61 Back     alignment and organism information
>gi|163869176|ref|YP_001610428.1| 50S ribosomal protein L32 [Bartonella tribocorum CIP 105476] Length = 59 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
PRK0111060 PRK01110, rpmF, 50S ribosomal protein L32; Validated 6e-14
PRK1228657 PRK12286, rpmF, 50S ribosomal protein L32; Reviewed 3e-13
COG033357 COG0333, RpmF, Ribosomal protein L32 [Translation, ribo 5e-12
TIGR0103155 TIGR01031, rpmF_bact, ribosomal protein L32 1e-10
pfam0178356 pfam01783, Ribosomal_L32p, Ribosomal L32p protein famil 5e-13
>gnl|CDD|179224 PRK01110, rpmF, 50S ribosomal protein L32; Validated Back     alignment and domain information
>gnl|CDD|183404 PRK12286, rpmF, 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>gnl|CDD|30681 COG0333, RpmF, Ribosomal protein L32 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|162165 TIGR01031, rpmF_bact, ribosomal protein L32 Back     alignment and domain information
>gnl|CDD|145114 pfam01783, Ribosomal_L32p, Ribosomal L32p protein family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
PRK1228659 rpmF 50S ribosomal protein L32; Reviewed 99.95
TIGR0103156 rpmF_bact ribosomal protein L32; InterPro: IPR002677 Ri 99.95
COG033357 RpmF Ribosomal protein L32 [Translation, ribosomal stru 99.93
PRK0111056 rpmF 50S ribosomal protein L32; Validated 99.92
pfam0178356 Ribosomal_L32p Ribosomal L32p protein family. 99.89
KOG4080176 consensus 98.42
PRK08271625 anaerobic ribonucleoside triphosphate reductase; Provis 93.68
PRK07111703 anaerobic ribonucleoside triphosphate reductase; Provis 91.06
TIGR00354 1173 polC DNA polymerase II, large subunit DP2; InterPro: IP 90.83
CHL0015253 rpl32 ribosomal protein L32; Validated 97.29
PRK05654 288 acetyl-CoA carboxylase subunit beta; Validated 92.34
CHL00174 305 accD acetyl-CoA carboxylase beta subunit; Reviewed 90.68
COG1645131 Uncharacterized Zn-finger containing protein [General f 90.39
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01110 rpmF 50S ribosomal protein L32; Validated Back     alignment and domain information
>pfam01783 Ribosomal_L32p Ribosomal L32p protein family Back     alignment and domain information
>KOG4080 consensus Back     alignment and domain information
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>TIGR00354 polC DNA polymerase II, large subunit DP2; InterPro: IPR004475 This family represents the large subunit, DP2, of a two subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus Back     alignment and domain information
>CHL00152 rpl32 ribosomal protein L32; Validated Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
1nwx_Z59 Complex Of The Large Ribosomal Subunit From Deinoco 1e-15
1jzx_M60 Structural Basis For The Interaction Of Antibiotics 2e-15
1pnu_Z58 Crystal Structure Of A Streptomycin Dependent Ribos 4e-15
3fin_559 T. Thermophilus 70s Ribosome In Complex With Mrna, 1e-13
2j01_560 Structure Of The Thermus Thermophilus 70s Ribosome 1e-13
3mrz_259 Recognition Of The Amber Stop Codon By Release Fact 3e-13
1vsa_Y60 Crystal Structure Of A 70s Ribosome-Trna Complex Re 3e-13
1vs6_057 Crystal Structure Of The Bacterial Ribosome From Es 5e-11
3pyo_252 Crystal Structure Of A Complex Containing Domain 3 2e-10
1p85_Z56 Real Space Refined Coordinates Of The 50s Subunit F 5e-10
>gi|29726812|pdb|1NWX|Z Chain Z, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 59 Back     alignment and structure
 Score = 86.1 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 31/56 (55%)

Query: 2  AVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL 57
           VPK+KTS SKR MRRS  ALT P   E  +    +  HH+    G Y GRQV  +
Sbjct: 4  PVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLAV 59


gi|16975051|pdb|1JZX|M Chain M, Structural Basis For The Interaction Of Antibiotics With The Peptidyl Transferase Center In Eubacteria Length = 60 Back     alignment and structure
>gi|34811579|pdb|1PNU|Z Chain Z, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 58 Back     alignment and structure
>gi|224510774|pdb|3FIN|5 Chain 5, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 59 Back     alignment and structure
gi|116668227|pdb|2J01|5 Chain 5, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 60 Back     alignment and structure
>gi|300508656|pdb|3MRZ|2 Chain 2, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 59 Back     alignment and structure
gi|149240910|pdb|1VSA|Y Chain Y, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 Length = 60 Back     alignment and structure
gi|116666595|pdb|1VS6|0 Chain 0, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 57 Back     alignment and structure
>gi|322812599|pdb|3PYO|2 Chain 2, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 52 Back     alignment and structure
>gi|33357924|pdb|1P85|Z Chain Z, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 56 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
2zjr_Z60 50S ribosomal protein L32; ribosome, large ribosomal su 3e-16
2j01_560 50S ribosomal protein L32; ribosome, tRNA, paromomycin, 8e-16
3i1n_057 50S ribosomal protein L32; ribosome structure, protein- 2e-13
3ofq_056 50S ribosomal protein L32; protein biosynthesis, riboso 6e-13
>2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 1nwy_Z* 1nwx_Z* 1xbp_Z* 1pnu_Z ... Length = 60 Back     alignment and structure
 Score = 78.9 bits (195), Expect = 3e-16
 Identities = 26/54 (48%), Positives = 30/54 (55%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
            VPK+KTS SKR MRRS  ALT P   E  +    +  HH+    G Y GRQV
Sbjct: 4  HPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQV 57


>2j01_5 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: g.41.8.5 PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 3hux_5 3huz_5 3f1f_5 1vsp_Y 1vsa_Y 3d5d_5 ... Length = 60 Back     alignment and structure
>3i1n_0 50S ribosomal protein L32; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_0 3e1b_T 3e1d_T 1vs6_0 3i1p_0 3i1r_0 3i1t_0 3i20_0 3i22_0 2qam_0* 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* ... Length = 57 Back     alignment and structure
>3ofq_0 50S ribosomal protein L32; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* 2qbe_0 2qbg_0 2qbi_0* 2qbk_0* 2qov_0 2qox_0 2qoz_0* 2qp1_0* 2rdo_0 2vhm_0 ... Length = 56 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
2j01_560 50S ribosomal protein L32; ribosome, tRNA, paromomycin, 99.94
2zjr_Z60 50S ribosomal protein L32; ribosome, large ribosomal su 99.94
3ofq_056 50S ribosomal protein L32; protein biosynthesis, riboso 99.91
2f9i_B 285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 93.62
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein comp 90.64
3bbo_257 Ribosomal protein L32; large ribosomal subunit, spinach 97.3
2f9y_B 304 Acetyl-coenzyme A carboxylase carboxyl transferase subu 91.1
>2j01_5 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: g.41.8.5 PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... Back     alignment and structure
Probab=99.94  E-value=6.5e-29  Score=171.03  Aligned_cols=57  Identities=42%  Similarity=0.670  Sum_probs=56.0

Q ss_pred             CCCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             978878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         1 MAVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
                      |||||+|+|+||+++|||||+|++|+|+.||+||++++||+||++||||+|||||++
T Consensus         4 ~~VPKrk~Sksr~~~RRsh~~l~~p~l~~C~~CG~~~~pHrvC~~CG~YkGr~Vi~v   60 (60)
T 2j01_5            4 HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV   60 (60)
T ss_dssp             SSCCSSCCCHHHHHHHHGGGCCCCCCCBCCSSSSSCBCTTCBCTTTCCSSSCCSCCC
T ss_pred             CCCCCCCCCCCCCHHHHCCCCCCCCCEEECCCCCCEECCCEECCCCCCCCCEEEEEC
T ss_conf             788878667201222201311258834689999970267368798981999985769



>2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 1nwy_Z* 1nwx_Z* 1xbp_Z* 1pnu_Z ... Back     alignment and structure
>3ofq_0 50S ribosomal protein L32; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* 2qbe_0 2qbg_0 2qbi_0* 2qbk_0* 2qov_0 2qox_0 2qoz_0* 2qp1_0* 2rdo_0 2vhm_0 ... Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>3bbo_2 Ribosomal protein L32; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
d2zjrz158 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus r 2e-16
d2j015159 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus therm 4e-16
d2qam0156 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia c 3e-13
>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Length = 58 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L32p
domain: Ribosomal protein L32p
species: Deinococcus radiodurans [TaxId: 1299]
 Score = 78.1 bits (193), Expect = 2e-16
 Identities = 26/54 (48%), Positives = 30/54 (55%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
            VPK+KTS SKR MRRS  ALT P   E  +    +  HH+    G Y GRQV
Sbjct: 3  HPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQV 56


>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Length = 59 Back     information, alignment and structure
>d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} Length = 56 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxId: 27 99.94
d2zjrz158 Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 99.94
d2qam0156 Ribosomal protein L32p {Escherichia coli [TaxId: 562]} 99.91
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methanococc 92.06
d2ey4e152 Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus 90.59
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L32p
domain: Ribosomal protein L32p
species: Thermus thermophilus [TaxId: 274]
Probab=99.94  E-value=7.5e-29  Score=169.47  Aligned_cols=57  Identities=42%  Similarity=0.670  Sum_probs=56.0

Q ss_pred             CCCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             978878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         1 MAVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
                      |+|||+|+|+||+++|||||+|++|+|+.|++||++++||+||++||||+|||||++
T Consensus         3 ~pVPKrk~Sksr~~~RRsh~~l~~p~l~~C~~CG~~~~pHrvC~~CG~YkGr~Vi~v   59 (59)
T d2j0151           3 HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV   59 (59)
T ss_dssp             SSCCSSCCCHHHHHHHHGGGCCCCCCCBCCSSSSSCBCTTCBCTTTCCSSSCCSCCC
T ss_pred             CCCCCCCCCCHHCHHHHCCCCCCCCCEEECCCCCCCCCCEEECCCCCEECCEEEEEC
T ss_conf             887777666010243311210358834688999981066068798980999986769



>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 61 ribosomal protein L32 [Candidatus Liberibacter asi
2j01_5_60 (5:) 50S ribosomal protein L32; ribosome, tRNA, pa 4e-15
2zjr_Z_60 (Z:) 50S ribosomal protein L32; ribosome, large ri 5e-15
>2j01_5 (5:) 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 60 Back     alignment and structure
 Score = 74.7 bits (184), Expect = 4e-15
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
            VPK+KTS ++R  RRS  ALTPP  V   +   ++ PH V  + G Y GR+V
Sbjct: 4  HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKV 57


>2zjr_Z (Z:) 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 60 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target61 ribosomal protein L32 [Candidatus Liberibacter asiaticu
2zjr_Z_60 50S ribosomal protein L32; ribosome, large ribosom 99.95
2j01_5_60 50S ribosomal protein L32; ribosome, tRNA, paromom 99.95
3i1n_0_23-5735 50S ribosomal protein L32; ribosome structure, pro 98.53
2f9i_B_1-6161 Acetyl-coenzyme A carboxylase carboxyl transferase 94.24
3bbo_2_57 Ribosomal protein L32; large ribosomal subunit, sp 97.53
>2zjr_Z (Z:) 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
Probab=99.95  E-value=5.7e-29  Score=172.13  Aligned_cols=57  Identities=46%  Similarity=0.635  Sum_probs=56.1

Q ss_pred             CCCCCCCCCHHCCCCHHHHHCCCCCCEEECCCCCCEEEEEEEECCCCCCCCEEEEEE
Q ss_conf             978878876100174122310268837887899782440464257786768796434
Q gi|254780361|r    1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVL   57 (61)
Q Consensus         1 MAVPKrK~S~sr~~~RRsh~~l~~p~l~~c~~cG~~~~~H~vc~~cG~YkGr~Vi~~   57 (61)
                      |||||+|+|+||+++|||||+|++|+|+.||+||++++||+||++||||+|||||++
T Consensus         4 MAVPKrk~Sksr~~~RRsh~kl~~p~l~~C~~cG~~~~pH~vC~~CG~Ykgr~v~~~   60 (60)
T 2zjr_Z            4 HPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLAV   60 (60)
T ss_dssp             CSCCSSCCCTTHHHHHTTTCCCCCCCCEECTTTCCEECTTBCCTTTCBSSSBCSCC-
T ss_pred             CCCCCCCCCCCCCHHHHCCHHHCCCCEEECCCCCCCCCCEEECCCCCCCCCEEEEEC
T ss_conf             787878667200221210033038861588999997466067698881999986769



>2j01_5 (5:) 50S ribosomal protein L32; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>3i1n_0 (0:23-57) 50S ribosomal protein L32; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_0 3e1b_T 3e1d_T 1vs6_0 3i1p_0 3i1r_0 3i1t_0 3i20_0 3i22_0 2qam_0* 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* ... Back     alignment and structure
>2f9i_B (B:1-61) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3bbo_2 (2:) Ribosomal protein L32; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure