255764465

255764465

Na+/H+ antiporter NhaA

GeneID in NCBI database:8209347Locus tag:CLIBASIA_01235
Protein GI in NCBI database:255764465Protein Accession:YP_003064775.2
Gene range:+(259515, 260663)Protein Length:382aa
Gene description:Na+/H+ antiporter NhaA
COG prediction:[P] Na+/H+ antiporter
KEGG prediction:nhaA; Na+/H+ antiporter NhaA; K03313 Na+:H+ antiporter, NhaA family
SEED prediction:Na+/H+ antiporter NhaA type
Pathway involved in KEGG:Methane metabolism [PATH:las00680]
Subsystem involved in SEED:Na(+) H(+) antiporter
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM11 TM-Helix
TOPPRED11 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM10 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK
cHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHcEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHcccccHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mtknkfflyrdNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGElsswtkrslpllgaiggitfPACIYMIINCHTeiylkgwaiptaTDIAFTLGILswigpnipssLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLlpdiknyhspsnriSFYLLGDglkswvmpLVLPAFVFVntgltistipytdisdpiVWGVMLGLFLGKQSGIFLFAFSTvkigwgklpkdtnwcllyggsilcgiGFTMSLFLTLqafpnannlqekAKIGIILSSVISIIYAYLVFKIPLRKK
mtknkfflyrdNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLvfkiplrkk
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKigiilssvisiiYAYLVFKIPLRKK
*TKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLP***************LLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLR**
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRK*
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK
MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
315122177401 Na+/H+ antiporter NhaA [Candidatus Liberibacter solanac 1 1e-152
167646578391 Na+/H+ antiporter NhaA [Caulobacter sp. K31] Length = 3 1 7e-83
296100857385 putative sodium-proton antiporter NhaA [Enterobacter cl 1 4e-77
238019608390 hypothetical protein VEIDISOL_01477 [Veillonella dispar 1 8e-77
189424454391 pH-dependent sodium/proton antiporter [Geobacter lovley 1 9e-77
269797667390 Na+/H+ antiporter NhaA [Veillonella parvula DSM 2008] L 1 1e-76
152973822382 putative sodium-proton antiporter NhaA [Klebsiella pneu 1 6e-76
189423909390 pH-dependent sodium/proton antiporter [Geobacter lovley 1 7e-76
152991713392 pH-dependent sodium/proton antiporter [Sulfurovum sp. N 1 9e-76
296274367393 Na+/H+ antiporter NhaA [Arcobacter nitrofigilis DSM 729 1 2e-75
>gi|315122177|ref|YP_004062666.1| Na+/H+ antiporter NhaA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 401 Back     alignment and organism information
 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 279/382 (73%), Positives = 335/382 (87%)

Query: 1   MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIANLTLRDWVNDILM 60
           +T  +  + +DNFTGILLISTT +T+I+ANISFSS+YYFD+LE+KI +LTL+DW+NDILM
Sbjct: 12  LTNIQSLIRQDNFTGILLISTTIMTIIVANISFSSSYYFDSLEFKIFHLTLKDWINDILM 71

Query: 61  ILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAI 120
           + YFFMIGL+LKH LIHGELSSWTKRSLPLLGAIGGI  PACIY++IN HTE  ++GWAI
Sbjct: 72  VFYFFMIGLDLKHALIHGELSSWTKRSLPLLGAIGGIICPACIYLLINRHTETAMRGWAI 131

Query: 121 PTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAI 180
           PTATDIAFTLGILS IG N P SLKIFFTALT+IDDFSA+AIMAIFYTQ++NL AL +AI
Sbjct: 132 PTATDIAFTLGILSLIGSNFPPSLKIFFTALTIIDDFSAVAIMAIFYTQNINLSALSIAI 191

Query: 181 TLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSN 240
            LI  +FLLN  G T+ FIYGFLGF+LW+ IF+SGIHTTVFG+I A+LLPDIK+    +N
Sbjct: 192 ALISWIFLLNLSGITHCFIYGFLGFWLWYFIFQSGIHTTVFGIIFAMLLPDIKSCCGRAN 251

Query: 241 RISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGI 300
           ++SFYLLGDGLK WV  L+LPAFVFVNTG TISTI YTDIS+PI+WG+ LGLF+GKQ GI
Sbjct: 252 KLSFYLLGDGLKYWVNLLILPAFVFVNTGFTISTISYTDISNPIIWGITLGLFIGKQMGI 311

Query: 301 FLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNANNLQEKAKIGI 360
           FLF+F+TVKIGWG +PK+++W LLYGGSILCGIGFTMSLFLT+QAFPNAN++QEKAK+GI
Sbjct: 312 FLFSFATVKIGWGDIPKNSSWNLLYGGSILCGIGFTMSLFLTVQAFPNANDMQEKAKVGI 371

Query: 361 ILSSVISIIYAYLVFKIPLRKK 382
           +L+S+IS I++YLV K P  +K
Sbjct: 372 LLASIISGIFSYLVLKYPWNRK 393


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|167646578|ref|YP_001684241.1| Na+/H+ antiporter NhaA [Caulobacter sp. K31] Length = 391 Back     alignment and organism information
>gi|296100857|ref|YP_003611003.1| putative sodium-proton antiporter NhaA [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 385 Back     alignment and organism information
>gi|238019608|ref|ZP_04600034.1| hypothetical protein VEIDISOL_01477 [Veillonella dispar ATCC 17748] Length = 390 Back     alignment and organism information
>gi|189424454|ref|YP_001951631.1| pH-dependent sodium/proton antiporter [Geobacter lovleyi SZ] Length = 391 Back     alignment and organism information
>gi|269797667|ref|YP_003311567.1| Na+/H+ antiporter NhaA [Veillonella parvula DSM 2008] Length = 390 Back     alignment and organism information
>gi|152973822|ref|YP_001338861.1| putative sodium-proton antiporter NhaA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 382 Back     alignment and organism information
>gi|189423909|ref|YP_001951086.1| pH-dependent sodium/proton antiporter [Geobacter lovleyi SZ] Length = 390 Back     alignment and organism information
>gi|152991713|ref|YP_001357434.1| pH-dependent sodium/proton antiporter [Sulfurovum sp. NBC37-1] Length = 392 Back     alignment and organism information
>gi|296274367|ref|YP_003656998.1| Na+/H+ antiporter NhaA [Arcobacter nitrofigilis DSM 7299] Length = 393 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
PRK09561388 PRK09561, nhaA, pH-dependent sodium/proton antiporter; 4e-97
PRK09560389 PRK09560, nhaA, pH-dependent sodium/proton antiporter; 9e-95
pfam06965374 pfam06965, Na_H_antiport_1, Na+/H+ antiporter 1 7e-92
TIGR00773373 TIGR00773, NhaA, Na+/H+ antiporter NhaA 4e-75
PRK14853423 PRK14853, nhaA, pH-dependent sodium/proton antiporter; 2e-69
PRK14854383 PRK14854, nhaA, pH-dependent sodium/proton antiporter; 6e-68
PRK14855423 PRK14855, nhaA, pH-dependent sodium/proton antiporter; 1e-64
PRK14856438 PRK14856, nhaA, pH-dependent sodium/proton antiporter; 3e-60
COG3004390 COG3004, NhaA, Na+/H+ antiporter [Inorganic ion transpo 1e-84
>gnl|CDD|181955 PRK09561, nhaA, pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>gnl|CDD|181954 PRK09560, nhaA, pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>gnl|CDD|148533 pfam06965, Na_H_antiport_1, Na+/H+ antiporter 1 Back     alignment and domain information
>gnl|CDD|162034 TIGR00773, NhaA, Na+/H+ antiporter NhaA Back     alignment and domain information
>gnl|CDD|184855 PRK14853, nhaA, pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>gnl|CDD|184856 PRK14854, nhaA, pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>gnl|CDD|184857 PRK14855, nhaA, pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>gnl|CDD|184858 PRK14856, nhaA, pH-dependent sodium/proton antiporter; Provisional Back     alignment and domain information
>gnl|CDD|32821 COG3004, NhaA, Na+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
PRK09561388 nhaA pH-dependent sodium/proton antiporter; Reviewed 100.0
TIGR00773415 NhaA Na+/H+ antiporter NhaA; InterPro: IPR004670 The Es 100.0
PRK09560382 nhaA pH-dependent sodium/proton antiporter; Reviewed 100.0
pfam06965374 Na_H_antiport_1 Na+/H+ antiporter 1. This family contai 100.0
COG3004390 NhaA Na+/H+ antiporter [Inorganic ion transport and met 100.0
pfam00999371 Na_H_Exchanger Sodium/hydrogen exchanger family. Na/H a 99.39
KOG1650 769 consensus 97.97
COG0475397 KefB Kef-type K+ transport systems, membrane components 99.36
PRK10669 558 putative cation:proton antiport protein; Provisional 97.2
PRK03659 602 glutathione-regulated potassium-efflux system protein K 98.39
PRK03562 615 glutathione-regulated potassium-efflux system protein K 97.98
TIGR00932314 2a37 transporter, monovalent cation:proton antiporter-2 96.26
KOG1291 503 consensus 92.13
>PRK09561 nhaA pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>TIGR00773 NhaA Na+/H+ antiporter NhaA; InterPro: IPR004670 The Escherichia coli NhaA Na+:H+ Antiporter (NhaA) protein probably functions in the regulation of the internal pH when the external pH is alkaline Back     alignment and domain information
>PRK09560 nhaA pH-dependent sodium/proton antiporter; Reviewed Back     alignment and domain information
>pfam06965 Na_H_antiport_1 Na+/H+ antiporter 1 Back     alignment and domain information
>COG3004 NhaA Na+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00999 Na_H_Exchanger Sodium/hydrogen exchanger family Back     alignment and domain information
>KOG1650 consensus Back     alignment and domain information
>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family; InterPro: IPR004771 Na^+/H^+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells Back     alignment and domain information
>KOG1291 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
1zcd_A388 Crystal Structure Of The Na+H+ ANTIPORTER NHAA Leng 1e-92
3fi1_A376 Nhaa Dimer Model Length = 376 2e-89
gi|71042270|pdb|1ZCD|A Chain A, Crystal Structure Of The Na+H+ ANTIPORTER NHAA Length = 388 Back     alignment and structure
 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 144/389 (37%), Positives = 218/389 (56%), Gaps = 13/389 (3%)

Query: 1   MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKI--------ANLTLR 52
           M     F   D   GI+LI    + MI+AN   +S +Y D LE  +         N  + 
Sbjct: 1   MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNML 60

Query: 53  DWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTE 112
            W+ND LM ++F ++GLE+K EL+ G L+S  + + P++ AIGG+  PA +Y+  N    
Sbjct: 61  LWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADP 120

Query: 113 IYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLN 172
           I  +GWAIP ATDIAF LG+L+ +G  +P +LKIF  AL +IDD  AI I+A+FYT  L+
Sbjct: 121 ITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLS 180

Query: 173 LFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDI 232
           + +L VA   I +L +LN CG     +Y  +G  LW ++ KSG+H T+ GVI+   +P  
Sbjct: 181 MASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK 240

Query: 233 KNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGL 292
           + +     R     L   L  WV  L+LP F F N G+++  +    ++  +  G++ GL
Sbjct: 241 EKHG----RSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGL 296

Query: 293 FLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPN-ANN 351
            +GK  GI LF +  +++    LP+ T +  +    ILCGIGFTMS+F+   AF +    
Sbjct: 297 LIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPE 356

Query: 352 LQEKAKIGIILSSVISIIYAYLVFKIPLR 380
           L   AK+GI++ S+ S +  Y   ++ LR
Sbjct: 357 LINWAKLGILVGSISSAVIGYSWLRVRLR 385


>gi|220702520|pdb|3FI1|A Chain A, Nhaa Dimer Model Length = 376 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
1zcd_A388 Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Esche 9e-79
>1zcd_A Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A Length = 388 Back     alignment and structure
 Score =  289 bits (740), Expect = 9e-79
 Identities = 145/385 (37%), Positives = 221/385 (57%), Gaps = 15/385 (3%)

Query: 7   FLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIA--------NLTLRDWVNDI 58
           F   D   GI+LI    + MI+AN   +S +Y D LE  +         N  +  W+ND 
Sbjct: 7   FFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNMLLWINDA 66

Query: 59  LMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGW 118
           LM ++F ++GLE+K EL+ G L+S  + + P++ AIGG+  PA +Y+  N    I  +GW
Sbjct: 67  LMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADPITREGW 126

Query: 119 AIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQV 178
           AIP ATDIAF LG+L+ +G  +P +LKIF  AL +IDD  AI I+A+FYT  L++ +L V
Sbjct: 127 AIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLSMASLGV 186

Query: 179 AITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNY-HS 237
           A   I +L +LN CG     +Y  +G  LW ++ KSG+H T+ GVI+   +P  + +  S
Sbjct: 187 AAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLKEKHGRS 246

Query: 238 PSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQ 297
           P+ R     L   L  WV  L+LP F F N G+++  +    ++  +  G++ GL +GK 
Sbjct: 247 PAKR-----LEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGKP 301

Query: 298 SGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNAN-NLQEKA 356
            GI LF +  +++    LP+ T +  +    ILCGIGFTMS+F+   AF + +  L   A
Sbjct: 302 LGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINWA 361

Query: 357 KIGIILSSVISIIYAYLVFKIPLRK 381
           K+GI++ S+ S +  Y   ++ LR 
Sbjct: 362 KLGILVGSISSAVIGYSWLRVRLRP 386


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
1zcd_A388 Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Esche 100.0
>1zcd_A Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A Back     alignment and structure
Probab=100.00  E-value=0  Score=888.41  Aligned_cols=377  Identities=37%  Similarity=0.703  Sum_probs=357.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH--HH--CCCCCC----CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             951478985321557999999999999833871243334--31--124335----6769999876799999999999999
Q gi|255764465|r    1 MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYF--DA--LEYKIA----NLTLRDWVNDILMILYFFMIGLELK   72 (382)
Q Consensus         1 ~~k~k~F~~~e~~~gilLl~aa~~Al~~ANs~~~~~y~~--~~--~~~~~~----~~~l~~wvNDgLMaiFFf~vGLEiK   72 (382)
                      |++.|+|+|+|++||++|+.+|++|++||||||.+.||+  ++  .+.+++    ++|+||||||+||++|||+||||+|
T Consensus         1 ~~~l~~f~~~e~~~gilLl~a~~~Ali~ANs~~~~~~Y~~~~~~~~~~~~g~~~~~~~l~~winD~LMalFFflvGLEik   80 (388)
T 1zcd_A            1 MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVK   80 (388)
T ss_dssp             --------CCSSHHHHHHHHHHHHHHHHHHCSSSHHHHHHHTTCEEEEEETTEEEEEEHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             91589998510368999999999999998797045689998606201442752467749999876899999999999998


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99864867899998999999877889999998982379800035045533773789999999842788899999999999
Q gi|255764465|r   73 HELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALT  152 (382)
Q Consensus        73 rE~~~GeLs~~r~a~lP~~AAlGGmi~Paliy~~~n~~~~~~~~GWaIP~ATDiAFalgvl~llg~rvp~~lrvFLlaLA  152 (382)
                      ||++.||||++||+++|.+||+|||++|+++|+.+|.++++..+||+|||||||||++++++++|+|+|+++|+||+++|
T Consensus        81 re~l~G~Ls~~~~a~lP~~Aa~GGm~~Pa~iyl~~n~~~~~~~~GWaiP~ATDIAfal~vl~llg~rvp~~lr~fLL~lA  160 (388)
T 1zcd_A           81 RELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALA  160 (388)
T ss_dssp             HHHHSTTTSSTTTSHHHHHHHHHHTTTTHHHHGGGCCSSTTHHHHTSSSSCCCHHHHHHHHHSSCSSSCSSSHHHHHHHH
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99873765637899989999985226999999863147875567750440238999999999974668748999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCC
Q ss_conf             87544799888864177666799999999999999986259861237899999999999712865678988886317678
Q gi|255764465|r  153 MIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDI  232 (382)
Q Consensus       153 IvDDlgaIlVIAifYs~~i~~~~L~~a~~~~~~l~~l~~~~v~~~~~y~~~g~~lW~~~~~sGIHaTiAGV~l~~~iP~~  232 (382)
                      |+||+|+|+|||+|||+++++.|+..+...+..++.+||+++++.++|.++|+++||++++||||||+|||++|+++|++
T Consensus       161 ivDDlgailvIA~fYt~~i~~~~l~~a~~~~~~~~~~~~~~v~~~~~y~~lg~~~W~~~~~sGVHatlagv~~gl~iP~~  240 (388)
T 1zcd_A          161 IIDDLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK  240 (388)
T ss_dssp             HHHHHHHHHHHHHHSCCCCCHHHHHHHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHHTTTSHHHHHHHHHHHHHHSCCC
T ss_pred             HHHCCCCHHHEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
T ss_conf             98301024211200166335999999999999999998528871008899999999999860555788877876112466


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             77789400003788763420443247879998851263246764787310269999999864455899999999996175
Q gi|255764465|r  233 KNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGW  312 (382)
Q Consensus       233 ~~~~~~~~~~~~~~le~~l~p~v~~~IlPlFAfaNaGV~l~~~~~~~~~~pv~~gI~~gL~iGK~lGI~~~s~lavkl~~  312 (382)
                      +++    +++|.+|+||.+||||+|+|+|+|||+|+||++++...+..++|+++||++||++|||+||++++|+++|+++
T Consensus       241 ~~~----~~sp~erlE~~l~p~v~~~ilPlFaf~nagv~l~~~~~~~~~~p~~~gI~~gL~vGK~lGI~~~~~la~kl~~  316 (388)
T 1zcd_A          241 EKH----GRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKL  316 (388)
T ss_dssp             GGG----SSCHHHHHHHHHHHHHHHTHHHHHHHHHCCCCCSSSCCCTHHHHSSTTTTHHHHHTTGGGSTTHHHHTSSCTT
T ss_pred             CCC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCHHHHHHHHHHCCCEEEEEEEEEHHHHHCCC
T ss_conf             556----7985888999867789999988999986031224540343017278777863121658898621189887054


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             4389998999999999987558999999866406872-57887655999999999999999999414778
Q gi|255764465|r  313 GKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNA-NNLQEKAKIGIILSSVISIIYAYLVFKIPLRK  381 (382)
Q Consensus       313 ~~lP~g~~w~~l~~v~~LaGIGFTmSLfIa~LAF~~~-~~~~~~aKlgIL~~S~~aailG~~~l~~~~~k  381 (382)
                      +++|++++|+|++++|+||||||||||||+++||++. ++++|++|+|||.+|++|+++|+.++|+++|-
T Consensus       317 ~~lP~g~~~~~l~~v~~LaGIGFTmSLfI~~lAf~~~~~~~~~~aK~giL~~S~~sa~~g~~~l~~~~rp  386 (388)
T 1zcd_A          317 AHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRP  386 (388)
T ss_dssp             TCCCCSCCGGGGTTHHHHTTCCHHHHHHHHHHHSTTSSCSSHHHHHHHHHHHHHTTTSTTTGGGTTTC--
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             7799999899999999999899999999999866799867771169999999999999999999724689




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 382 Na+/H+ antiporter NhaA [Candidatus Liberibacter as
1zcd_A_388 (A:) Na(+)/H(+) antiporter 1; membrane protein; 3. 7e-13
>1zcd_A (A:) Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_ALength = 388 Back     alignment and structure
 Score = 69.5 bits (169), Expect = 7e-13
 Identities = 139/379 (36%), Positives = 213/379 (56%), Gaps = 13/379 (3%)

Query: 13  FTGILLISTTFITMILANISFSSAYYFDALEY--------KIANLTLRDWVNDILMILYF 64
             GI+LI    + MI+AN   +S +Y D LE            N  +  W+ND LM ++F
Sbjct: 13  SGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNMLLWINDALMAVFF 72

Query: 65  FMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTAT 124
            ++GLE+K EL+ G L+S  + + P++ AIGG+  PA +Y+  N    I  +GWAIP AT
Sbjct: 73  LLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADPITREGWAIPAAT 132

Query: 125 DIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIMAIFYTQSLNLFALQVAITLIF 184
           DIAF LG+L+ +G  +P +LKIF  AL +IDD  AI I+A+FYT  L++ +L VA   I 
Sbjct: 133 DIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLSMASLGVAAVAIA 192

Query: 185 LLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDIKNYHSPSNRISF 244
           +L +LN CG     +Y  +G  LW ++ KSG+H T+ GVI+   +P  + +     +   
Sbjct: 193 VLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLKEKHGRSPAKR-- 250

Query: 245 YLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFA 304
             L   L  WV  L+LP F F N G+++  +    ++  +  G++ GL +GK  GI LF 
Sbjct: 251 --LEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGKPLGISLFC 308

Query: 305 FSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLFL-TLQAFPNANNLQEKAKIGIILS 363
           +  +++    LP+ T +  +    ILCGIGFTMS+F+ +L        L   AK+GI++ 
Sbjct: 309 WLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINWAKLGILVG 368

Query: 364 SVISIIYAYLVFKIPLRKK 382
           S+ S +  Y   ++ LR  
Sbjct: 369 SISSAVIGYSWLRVRLRPS 387


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target382 Na+/H+ antiporter NhaA [Candidatus Liberibacter asiatic
1zcd_A_388 Na(+)/H(+) antiporter 1; membrane protein; 3.45A { 99.87
>1zcd_A (A:) Na(+)/H(+) antiporter 1; membrane protein; 3.45A {Escherichia coli} PDB: 3fi1_A Back     alignment and structure
Probab=99.87  E-value=5.9e-21  Score=144.29  Aligned_cols=378  Identities=38%  Similarity=0.704  Sum_probs=309.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCC--------CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             95147898532155799999999999983387124333431124335--------6769999876799999999999999
Q gi|255764465|r    1 MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYKIA--------NLTLRDWVNDILMILYFFMIGLELK   72 (382)
Q Consensus         1 ~~k~k~F~~~e~~~gilLl~aa~~Al~~ANs~~~~~y~~~~~~~~~~--------~~~l~~wvNDgLMaiFFf~vGLEiK   72 (382)
                      ||....+.+.+..-+++++.+.....+.......+.--....+.-.|        +....++..+.-+.++.|..|+|++
T Consensus         1 ~~~~~~~~~~~~~i~~il~~~~~~~~l~~~~~lP~~~~~il~GillGp~~l~~~~~~~~~~~~~~lgl~~llF~~Gleld   80 (388)
T 1zcd_A            1 MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVK   80 (388)
T ss_dssp             --------CCSSHHHHHHHHHHHHHHHHHHCSSSHHHHHHHTTCEEEEEETTEEEEEEHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             90589988323168999999999999998797025689999706300332742356529999886799999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99864867899998999999877889999998982379800035045533773789999999842788899999999999
Q gi|255764465|r   73 HELIHGELSSWTKRSLPLLGAIGGITFPACIYMIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALT  152 (382)
Q Consensus        73 rE~~~GeLs~~r~a~lP~~AAlGGmi~Paliy~~~n~~~~~~~~GWaIP~ATDiAFalgvl~llg~rvp~~lrvFLlaLA  152 (382)
                      .+......+.....+.+.......+......|+..+....+..-.+++.++||.+-.+.++.-.+++.+..++..+..-+
T Consensus        81 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ts~~~v~~~l~~~~~~~~~~~~~~~~~~~  160 (388)
T 1zcd_A           81 RELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALA  160 (388)
T ss_dssp             HHHHSTTTSSTTTSHHHHHHHHHHTTTTHHHHGGGCCSSTTHHHHTSSSSCCCHHHHHHHHHSSCSSSCSSSHHHHHHHH
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             98744777746788988999971541878988751137887675478754750899999999964779848999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCC
Q ss_conf             87544799888864177666799999999999999986259861237899999999999712865678988886317678
Q gi|255764465|r  153 MIDDFSAIAIMAIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFGVIMALLLPDI  232 (382)
Q Consensus       153 IvDDlgaIlVIAifYs~~i~~~~L~~a~~~~~~l~~l~~~~v~~~~~y~~~g~~lW~~~~~sGIHaTiAGV~l~~~iP~~  232 (382)
                      +.||..+++...++++...+.....................+.+...+.......++...+.+.+..++.+..+..++..
T Consensus       161 ~~~d~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (388)
T 1zcd_A          161 IIDDLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK  240 (388)
T ss_dssp             HHHHHHHHHHHHHHSCCCCCHHHHHHHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHHTTTSHHHHHHHHHHHHHHSCCC
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC
T ss_conf             97425646652000366433999999999999999999628770688988999999999970676477655666314665


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             77789400003788763420443247879998851263246764787310269999999864455899999999996175
Q gi|255764465|r  233 KNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDISDPIVWGVMLGLFLGKQSGIFLFAFSTVKIGW  312 (382)
Q Consensus       233 ~~~~~~~~~~~~~~le~~l~p~v~~~IlPlFAfaNaGV~l~~~~~~~~~~pv~~gI~~gL~iGK~lGI~~~s~lavkl~~  312 (382)
                      ....    ....++.++..++.........|.+...+.+....................+.++|.+++...++...+...
T Consensus       241 ~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (388)
T 1zcd_A          241 EKHG----RSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKL  316 (388)
T ss_dssp             GGGS----SCHHHHHHHHHHHHHHHTHHHHHHHHHCCCCCSSSCCCTHHHHSSTTTTHHHHHTTGGGSTTHHHHTSSCTT
T ss_pred             CCCC----CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHEECCCEEEEEEEEHHHHHCCC
T ss_conf             5578----997999999874005665566877640351335665224445578866742121705798745499887364


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4389998999999999987558999999866406872-578876559999999999999999994147789
Q gi|255764465|r  313 GKLPKDTNWCLLYGGSILCGIGFTMSLFLTLQAFPNA-NNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK  382 (382)
Q Consensus       313 ~~lP~g~~w~~l~~v~~LaGIGFTmSLfIa~LAF~~~-~~~~~~aKlgIL~~S~~aailG~~~l~~~~~kk  382 (382)
                      ...+.+.+|++...++..++.++.+++....++...- ++.....-..++..++++....-...|..+||+
T Consensus       317 ~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~vi~s~~i~~~~~~~~~~~~~~~~  387 (388)
T 1zcd_A          317 AHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPS  387 (388)
T ss_dssp             TCCCCSCCGGGGTTHHHHTTCCHHHHHHHHHHHSTTSSCSSHHHHHHHHHHHHHTTTSTTTGGGTTTC---
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             67999998899999999988999999999998558998677722699999999999999999997336899