254780368

254780368

electron transfer flavoprotein beta subunit

GeneID in NCBI database:8209353Locus tag:CLIBASIA_01265
Protein GI in NCBI database:254780368Protein Accession:YP_003064781.1
Gene range:+(266258, 267007)Protein Length:249aa
Gene description:electron transfer flavoprotein beta subunit
COG prediction:[C] Electron transfer flavoprotein, beta subunit
KEGG prediction:etfB; electron transfer flavoprotein beta subunit; K03521 electron transfer flavoprotein beta subunit
SEED prediction:Electron transfer flavoprotein, beta subunit
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL
cEEEEEEEEccccccEEEEEccccccccccccHHccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHccccEEEEEEEEEEccEEEEEEEccccEEEEEEcccEEEEEEccccccccccHHHHHHHcccccccccHHHHcccccccEEEEEEEccccccccEEEccHHHHHHHHHHHcccc
cEEEEEccEEEcccccccEccccccEccccccEEEcHHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEEccEEEEEEEEccEEEEEcHHHcccccccHHHHHHcccccEEEEcHHHHcccccccEEEEEEEccccccccEEcccHHHHHHHHHHHcccc
mkilvpikgvinyntkvrikndysgietentkismnpfdEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLamgadrgiliesnetleplSIAKILREIVKKENPIIVIAgkqttdnesnQTGQMLAALmrwpqatfvsnikiidnhaivtrevghgtmtmetplpAVITVdlnlnepryislPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAerkglrlySTTKLIEILKSKHDLL
mkilvpikgvinyntkvrikndysgietentkismnpfDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLamgadrgiliesnetleplSIAKILREIVKKENPIIVIagkqttdnesNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRiekkkatdfaidltprlkvlrfeenraerkglrlysttklieilkskhdll
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNiikarkkriekkkaTDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVL**************YSTTKLIEILKSKHDLL
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL
MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target249 electron transfer flavoprotein beta subunit [Candidatus
315121836249 electron transfer flavoprotein beta subunit [Candidatus 1 1e-110
218679809249 electron transport flavoprotein, beta subunit [Rhizobiu 1 4e-76
307943484249 electron transfer flavoprotein subunit beta [Roseibium 1 5e-76
332186705249 electron transfer flavodomain protein [Sphingomonas sp. 1 3e-75
115350992249 electron transfer flavoprotein subunit beta [Burkholder 1 6e-75
153008346248 electron transfer flavoprotein alpha/beta-subunit [Ochr 1 9e-75
186475527249 electron transfer flavoprotein alpha/beta-subunit [Burk 1 1e-74
254472150249 electron transfer flavoprotein beta chain [Pseudovibrio 1 1e-74
209552154249 electron transfer flavoprotein alpha/beta-subunit [Rhiz 1 1e-74
170698400249 Electron transfer flavoprotein alpha/beta-subunit [Burk 1 2e-74
>gi|315121836|ref|YP_004062325.1| electron transfer flavoprotein beta subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 249 Back     alignment and organism information
 Score =  400 bits (1029), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 222/249 (89%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIKGVI+YN KVRIK D SGIE +N K+S+NPFDEIALEESL+L+EKGIATEVIV
Sbjct: 1   MKILVPIKGVIDYNAKVRIKIDGSGIEQDNMKMSINPFDEIALEESLRLKEKGIATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ KVE VLKN+LAMGADRGI IESNE LE LSIAKIL EIVK+E PI VIAGKQTT
Sbjct: 61  VSIGTYKVEAVLKNALAMGADRGIFIESNEILESLSIAKILCEIVKQEKPIAVIAGKQTT 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DNESNQTGQMLAAL+ WPQATFVS I++  +HAI  RE+GHGTMT+E PLPAVITVDLNL
Sbjct: 121 DNESNQTGQMLAALLGWPQATFVSKIEMSGDHAITVREMGHGTMTIEIPLPAVITVDLNL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRYISLPNI+KARKK++EKK A+DFAI+LTPRLKVL+FEENRAER   RLYS T+LIE
Sbjct: 181 NEPRYISLPNILKARKKQLEKKMASDFAINLTPRLKVLKFEENRAERTSSRLYSATELIE 240

Query: 241 ILKSKHDLL 249
            LKSKH LL
Sbjct: 241 TLKSKHGLL 249


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218679809|ref|ZP_03527706.1| electron transport flavoprotein, beta subunit [Rhizobium etli CIAT 894] Length = 249 Back     alignment and organism information
>gi|307943484|ref|ZP_07658828.1| electron transfer flavoprotein subunit beta [Roseibium sp. TrichSKD4] Length = 249 Back     alignment and organism information
>gi|332186705|ref|ZP_08388448.1| electron transfer flavodomain protein [Sphingomonas sp. S17] Length = 249 Back     alignment and organism information
>gi|115350992|ref|YP_772831.1| electron transfer flavoprotein subunit beta [Burkholderia ambifaria AMMD] Length = 249 Back     alignment and organism information
>gi|153008346|ref|YP_001369561.1| electron transfer flavoprotein alpha/beta-subunit [Ochrobactrum anthropi ATCC 49188] Length = 248 Back     alignment and organism information
>gi|186475527|ref|YP_001856997.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia phymatum STM815] Length = 249 Back     alignment and organism information
>gi|254472150|ref|ZP_05085550.1| electron transfer flavoprotein beta chain [Pseudovibrio sp. JE062] Length = 249 Back     alignment and organism information
>gi|209552154|ref|YP_002284070.1| electron transfer flavoprotein alpha/beta-subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 249 Back     alignment and organism information
>gi|170698400|ref|ZP_02889473.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia ambifaria IOP40-10] Length = 249 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target249 electron transfer flavoprotein beta subunit [Candidatus
COG2086260 COG2086, FixA, Electron transfer flavoprotein, beta sub 2e-59
PRK03359256 PRK03359, PRK03359, putative electron transfer flavopro 4e-12
KOG3180254 KOG3180, KOG3180, KOG3180, Electron transfer flavoprote 2e-68
cd01714202 cd01714, ETF_beta, The electron transfer flavoprotein ( 8e-57
cd01985181 cd01985, ETF, The electron transfer flavoprotein (ETF) 2e-31
pfam01012161 pfam01012, ETF, Electron transfer flavoprotein domain 8e-27
PRK12342254 PRK12342, PRK12342, hypothetical protein; Provisional 7e-13
>gnl|CDD|32269 COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179569 PRK03359, PRK03359, putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>gnl|CDD|38390 KOG3180, KOG3180, KOG3180, Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30169 cd01714, ETF_beta, The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>gnl|CDD|30172 cd01985, ETF, The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>gnl|CDD|144557 pfam01012, ETF, Electron transfer flavoprotein domain Back     alignment and domain information
>gnl|CDD|183455 PRK12342, PRK12342, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 249 electron transfer flavoprotein beta subunit [Candidatus
PRK03359256 putative electron transfer flavoprotein FixA; Reviewed 100.0
PRK12342254 putative electron transfer flavoprotein YdiQ; Provision 100.0
COG2086260 FixA Electron transfer flavoprotein, beta subunit [Ener 100.0
KOG3180254 consensus 100.0
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) serve 100.0
cd01985181 ETF The electron transfer flavoprotein (ETF) serves as 100.0
pfam01012161 ETF Electron transfer flavoprotein domain. This family 99.93
PRK11916312 electron transfer flavoprotein subunit YdiR; Provisiona 99.21
cd01715168 ETF_alpha The electron transfer flavoprotein (ETF) serv 99.12
PRK03363313 fixB putative electron transfer flavoprotein FixB; Prov 98.99
COG2025313 FixB Electron transfer flavoprotein, alpha subunit [Ene 98.93
KOG3954336 consensus 97.58
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfamily 95.99
cd00293130 USP_Like Usp: Universal stress protein family. The univ 95.79
PRK11175304 universal stress protein UspE; Provisional 95.24
LOAD_USPA135 consensus 94.99
cd01987124 USP_OKCHK USP domain is located between the N-terminal 94.88
PRK10116142 universal stress protein UspC; Provisional 93.67
pfam00582140 Usp Universal stress protein family. The universal stre 90.98
TIGR02076232 pyrH_arch uridylate kinase, putative; InterPro: IPR0118 90.86
TIGR01278 562 DPOR_BchB light-independent protochlorophyllide reducta 91.31
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK12342 putative electron transfer flavoprotein YdiQ; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG3180 consensus Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>pfam01012 ETF Electron transfer flavoprotein domain Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG3954 consensus Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>LOAD_USPA consensus Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>pfam00582 Usp Universal stress protein family Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit; InterPro: IPR005969 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target249 electron transfer flavoprotein beta subunit [Candidatus
1efp_B252 Electron Transfer Flavoprotein (Etf) From Paracoccu 1e-57
1efv_B255 Three-Dimensional Structure Of Human Electron Trans 2e-57
2a1t_S255 Structure Of The Human Mcad:etf E165betaa Complex L 6e-57
1o94_C264 Ternary Complex Between Trimethylamine Dehydrogenas 2e-30
gi|5822052|pdb|1EFP|B Chain B, Electron Transfer Flavoprotein (Etf) From Paracoccus Denitrificans Length = 252 Back     alignment and structure
 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 178/253 (70%), Gaps = 5/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K +I+YN K R+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG A E+I 
Sbjct: 1   MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETL----EPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  E L+ +LAMGADR IL+ + + +    EPL++AKIL  + + E   ++IAG
Sbjct: 61  VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA++ W QATF S ++I    A VTREV  G  T+   LPAV+T 
Sbjct: 121 KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V+   E    + G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD 240

Query: 237 KLIEILKSKHDLL 249
           +L+  LK +  ++
Sbjct: 241 ELVGKLK-EAGVI 252


gi|2781203|pdb|1EFV|B Chain B, Three-Dimensional Structure Of Human Electron Transfer Flavoprotein To 2.1 A Resolution Length = 255 Back     alignment and structure
>gi|71042617|pdb|2A1T|S Chain S, Structure Of The Human Mcad:etf E165betaa Complex Length = 255 Back     alignment and structure
gi|28949074|pdb|1O94|C Chain C, Ternary Complex Between Trimethylamine Dehydrogenase And Electron Transferring Flavoprotein Length = 264 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target249 electron transfer flavoprotein beta subunit [Candidatus
1efv_B255 Electron transfer flavoprotein; electron transport, glu 3e-72
1efp_B252 ETF, protein (electron transfer flavoprotein); electron 5e-72
1o97_C264 Electron transferring flavoprotein beta-subunit; FAD bi 5e-53
3fet_A166 Electron transfer flavoprotein subunit alpha related pr 0.001
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Length = 255 Back     alignment and structure
 Score =  266 bits (682), Expect = 3e-72
 Identities = 110/247 (44%), Positives = 162/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Length = 252 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Length = 264 Back     alignment and structure
>3fet_A Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Length = 166 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target249 electron transfer flavoprotein beta subunit [Candidatus
1efp_B252 ETF, protein (electron transfer flavoprotein); electron 100.0
1efv_B255 Electron transfer flavoprotein; electron transport, glu 100.0
1o97_C264 Electron transferring flavoprotein beta-subunit; FAD bi 100.0
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alpha-bet 99.61
1o97_D320 Electron transferring flavoprotein alpha-subunit; FAD b 99.48
3fet_A166 Electron transfer flavoprotein subunit alpha related pr 99.2
1efv_A315 Electron transfer flavoprotein; electron transport, glu 98.78
1efp_A307 ETF, protein (electron transfer flavoprotein); electron 98.39
3mt0_A290 Uncharacterized protein PA1789; structural genomics, PS 94.16
3dlo_A155 Universal stress protein; unknown function, structural 94.02
1q77_A138 Hypothetical protein AQ_178; structural genomics, unive 93.37
3hgm_A147 Universal stress protein TEAD; rossman fold, signaling 93.02
3olq_A319 Universal stress protein E; structural genomics, PSI-2, 92.74
2z08_A137 Universal stress protein family; uncharacterized conser 92.45
3loq_A294 Universal stress protein; structural genomics, PSI-2, p 91.22
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hypothe 91.15
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
Probab=100.00  E-value=0  Score=525.50  Aligned_cols=248  Identities=50%  Similarity=0.819  Sum_probs=239.9

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101588888785077
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |||+||+|||||++++++++++++.+++++++++|||||+||||+||||||+++|++|+++||||++++++||+|||||+
T Consensus         1 MkI~V~vK~VpD~~~~~~i~~~~~~~~~~~~~~~inp~D~~AlE~Al~lke~~~g~~V~v~s~G~~~~~~~lr~alamGa   80 (252)
T 1efp_B            1 MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAETLRTALAMGA   80 (252)
T ss_dssp             CEEEEECCEEECTTSCCCBCTTSSCBCCTTCCEEECHHHHHHHHHHHHHHTTTSCSEEEEEEEESGGGHHHHHHHHHHTC
T ss_pred             CEEEEEEEECCCCCCEEEECCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             97999999677888636883899878224683246854699999999975427980999999663787999998862379


Q ss_pred             CCCEEEECC----CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEE
Q ss_conf             762376336----5478899999999986126864999961135888612899999985796133244334328659999
Q gi|254780368|r   81 DRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVT  156 (249)
Q Consensus        81 D~ai~i~d~----~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~  156 (249)
                      |+++++.++    +++|+++||++||.++++.+|||||||+||+|+++||||+++|++|||||+|+|.+++++++.++++
T Consensus        81 d~a~~i~~~~~~~~~~d~~~ta~~la~~~~~~~~DLIl~G~~s~D~~~g~vg~~lAe~Lg~P~vt~v~~ie~~~~~~~v~  160 (252)
T 1efp_B           81 DRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVT  160 (252)
T ss_dssp             SEEEEEECCSSTTCCCCHHHHHHHHHHHHHHHTCSEEEEESCCTTTCCCCHHHHHHHHHTCEEEEEEEEEEECSSEEEEE
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHCCCCCEEEEEEEEEECCEEEEE
T ss_conf             82699992453466778999999999998741999999983256678884216889762898135789999829979999


Q ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCCCCCEEEEEEECCCCCCCCEEECCHH
Q ss_conf             83589679999639889998435565454698889988521661204989076666845799951788524745537999
Q gi|254780368|r  157 REVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT  236 (249)
Q Consensus       157 r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~~~~p~~~~~g~~~e~~~  236 (249)
                      |+.++|+|++++++|||+||+.++|+||||||++||+|+|||+++|+++|+|++..|++++.++++|+.|++++++++++
T Consensus       161 r~~e~g~e~ve~~lPavitv~~~~n~PR~pslk~im~A~kk~i~~~~~~dlg~~~~~~~~~~~~~~p~~r~~~~~~~~~~  240 (252)
T 1efp_B          161 REVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD  240 (252)
T ss_dssp             EEETTEEEEEEEESSEEEEECTTSCCCCCCCHHHHHHHTTSCEEEEEGGGGTCCCCCSEEEEEEECCCCCCCCEECSSHH
T ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHCCCCEECCHHHCCCCCCCCEEEEEEECCCCCCCCEECCCHH
T ss_conf             99689489999459779996568787767898899986158841717999498878855999984799884885868999


Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             9999999861769
Q gi|254780368|r  237 KLIEILKSKHDLL  249 (249)
Q Consensus       237 eLv~~L~~e~~vi  249 (249)
                      ||+++|| |++||
T Consensus       241 elv~~L~-e~gvI  252 (252)
T 1efp_B          241 ELVGKLK-EAGVI  252 (252)
T ss_dssp             HHHTTC-------
T ss_pred             HHHHHHH-HCCCC
T ss_conf             9999998-86899



>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>3fet_A Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.97A {Archaeoglobus fulgidus} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 249 electron transfer flavoprotein beta subunit [Candidatus
d1efpb_246 c.26.2.3 (B:) Small, beta subunit of electron transfer 2e-61
d1efvb_252 c.26.2.3 (B:) Small, beta subunit of electron transfer 2e-54
d3clsc1262 c.26.2.3 (C:1-262) Small, beta subunit of electron tran 2e-44
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Length = 246 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: ETFP subunits
domain: Small, beta subunit of electron transfer flavoprotein ETFP
species: Paracoccus denitrificans [TaxId: 266]
 Score =  229 bits (585), Expect = 2e-61
 Identities = 123/246 (50%), Positives = 174/246 (70%), Gaps = 4/246 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K +I+YN K R+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG A E+I 
Sbjct: 1   MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  E L+ +LAMGADR IL+    +  + +EPL++AKIL  + + E   ++IAG
Sbjct: 61  VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA++ W QATF S ++I    A VTREV  G  T+   LPAV+T 
Sbjct: 121 KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V+   E    + G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD 240

Query: 237 KLIEIL 242
           +L+  L
Sbjct: 241 ELVGKL 246


>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Length = 252 Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Length = 262 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target249 electron transfer flavoprotein beta subunit [Candidatus
d1efvb_252 Small, beta subunit of electron transfer flavoprotein E 100.0
d1efpb_246 Small, beta subunit of electron transfer flavoprotein E 100.0
d3clsc1262 Small, beta subunit of electron transfer flavoprotein E 100.0
d3clsd1192 Large, alpha subunit of electron transfer flavoprotein 99.63
d1efpa1183 Large, alpha subunit of electron transfer flavoprotein 98.73
d1efva1188 Large, alpha subunit of electron transfer flavoprotein 99.02
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 6 95.0
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilus [Ta 93.56
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococcus j 92.48
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: ETFP subunits
domain: Small, beta subunit of electron transfer flavoprotein ETFP
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=531.26  Aligned_cols=248  Identities=44%  Similarity=0.732  Sum_probs=240.5

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101588888785077
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |||+||+|||||++++++++++++.+++++++++|||||+||||+||||||+++|.+|++++|||++++++||+|||||+
T Consensus         1 M~I~VcvKqVPD~~~~i~i~~~~~~l~~~~~~~~iNp~D~~AlE~Al~lke~~gg~~v~v~~~gp~~a~~~lr~ala~Ga   80 (252)
T d1efvb_           1 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGA   80 (252)
T ss_dssp             CEEEEECCEEECTTSCCCBCTTSSSBCCTTCCEEECHHHHHHHHHHHHHHHTTSCSEEEEEEEESTTHHHHHHHHHHHTC
T ss_pred             CEEEEEEEECCCCCCCEEECCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             97999998667887705981899868706984235830099999999976504883599997262667999999985478


Q ss_pred             CCCEEEECCC----CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEE
Q ss_conf             7623763365----478899999999986126864999961135888612899999985796133244334328659999
Q gi|254780368|r   81 DRGILIESNE----TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVT  156 (249)
Q Consensus        81 D~ai~i~d~~----~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~  156 (249)
                      |+++|++++.    +.|++++++++++++++.+|||||||+||+|+++||||+++|++|||||+|+|.++++++++++++
T Consensus        81 d~avli~~~~~~~~~~~~~~~a~~~a~~~~~~~~DLIl~G~~s~D~~tgqVg~~lAe~Lg~P~vt~v~~i~~~~~~i~v~  160 (252)
T d1efvb_          81 DRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVE  160 (252)
T ss_dssp             SEEEEEECCHHHHTTCCHHHHHHHHHHHHHHHTCSEEEEESCCTTTCCCCHHHHHHHHHTCCEEEEEEEEEEETTEEEEE
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCHHCCCCCHHHHHHHHCCCCCEEEEEEEEEECCEEEEE
T ss_conf             62499972310243221999999999987542998999944320036770777878755977336899999979999999


Q ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCCCCCEEEEEEECCCCCCCCEEECCHH
Q ss_conf             83589679999639889998435565454698889988521661204989076666845799951788524745537999
Q gi|254780368|r  157 REVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT  236 (249)
Q Consensus       157 r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~~~~p~~~~~g~~~e~~~  236 (249)
                      |++|+|+|+++++||||+||++++|+||||||++||+|+||||++|+++|||++..|++++.+++.|++|++|+++++++
T Consensus       161 R~~e~g~e~ve~~lPavitv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~~~~s~~~v~~~~~p~~~~~g~~ie~~~  240 (252)
T d1efvb_         161 REIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE  240 (252)
T ss_dssp             EEETTEEEEEEEESSEEEEECGGGCCCCCCCHHHHHHTTTSCEEEECHHHHTCCCCCSEEEEEEECCCCCCCCEECSSHH
T ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEECHHHCCCCCCCCCEEEEEECCCCCCCCEEEECHH
T ss_conf             99479199999459789994067676675345568986368837967899588868972799987399888970964899


Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999986176
Q gi|254780368|r  237 KLIEILKSKHDL  248 (249)
Q Consensus       237 eLv~~L~~e~~v  248 (249)
                      +|+++|++|++|
T Consensus       241 ~lv~~L~e~g~i  252 (252)
T d1efvb_         241 DLVAKLKEIGRI  252 (252)
T ss_dssp             HHHHHHHHTTCC
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999864689



>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpa1 c.26.2.3 (A:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 249 electron transfer flavoprotein beta subunit [Candi
1efp_B_1-223223 (B:1-223) ETF, protein (electron transfer flavopro 9e-53
1efv_B_1-226226 (B:1-226) Electron transfer flavoprotein; electron 6e-50
1o97_C_1-228228 (C:1-228) Electron transferring flavoprotein beta- 1e-44
1efp_A_1-179179 (A:1-179) ETF, protein (electron transfer flavopro 3e-33
1o97_D_1-188188 (D:1-188) Electron transferring flavoprotein alpha 9e-31
1efv_A_1-183183 (A:1-183) Electron transfer flavoprotein; electron 2e-29
3fet_A_166 (A:) Electron transfer flavoprotein subunit alpha 3e-31
3ih5_A_1-122_163-217177 (A:1-122,A:163-217) Electron transfer flavoprotein 6e-20
>1efp_B (B:1-223) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 223 Back     alignment and structure
 Score =  201 bits (512), Expect = 9e-53
 Identities = 118/222 (53%), Positives = 163/222 (73%), Gaps = 4/222 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K +I+YN K R+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG A E+I 
Sbjct: 1   MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  E L+ +LAMGADR IL+ +     + +EPL++AKIL  + + E   ++IAG
Sbjct: 61  VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA++ W QATF S ++I    A VTREV  G  T+   LPAV+T 
Sbjct: 121 KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVL 218
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V+
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVV 222


>1efv_B (B:1-226) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 226 Back     alignment and structure
>1o97_C (C:1-228) Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus}Length = 228 Back     alignment and structure
>1efp_A (A:1-179) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 179 Back     alignment and structure
>1o97_D (D:1-188) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus}Length = 188 Back     alignment and structure
>1efv_A (A:1-183) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 183 Back     alignment and structure
>3fet_A (A:) Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum}Length = 166 Back     alignment and structure
>3ih5_A (A:1-122,A:163-217) Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron}Length = 177 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target249 electron transfer flavoprotein beta subunit [Candidatus
1efv_B_1-226226 Electron transfer flavoprotein; electron transport 100.0
1efp_B_1-223223 ETF, protein (electron transfer flavoprotein); ele 100.0
1o97_C_1-228228 Electron transferring flavoprotein beta-subunit; F 100.0
1o97_D_1-188188 Electron transferring flavoprotein alpha-subunit; 99.93
3fet_A_166 Electron transfer flavoprotein subunit alpha relat 99.93
1efv_A_1-183183 Electron transfer flavoprotein; electron transport 99.91
1efp_A_1-179179 ETF, protein (electron transfer flavoprotein); ele 99.85
3ih5_A_1-122_163-217177 Electron transfer flavoprotein alpha-subunit; alph 99.64
3dlo_A_155 Universal stress protein; unknown function, struct 94.57
2z08_A_137 Universal stress protein family; uncharacterized c 93.8
1mjh_A_162 Protein (ATP-binding domain of protein MJ0577); hy 93.55
3fg9_A_14-156143 Protein of universal stress protein USPA family; A 93.26
2pfs_A_150 USP, universal stress protein; structural genomics 91.82
2dum_A_170 Hypothetical protein PH0823; conserved hypothetica 91.71
3fdx_A_143 Putative filament protein / universal stress prote 90.18
2gm3_A_175 Unknown protein; AT3G01520, putative ethylene-resp 90.14
1q77_A_138 Hypothetical protein AQ_178; structural genomics, 90.91
>1efv_B (B:1-226) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=329.00  Aligned_cols=219  Identities=47%  Similarity=0.783  Sum_probs=210.4

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101588888785077
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |||+||+|||||+..++++++++..+..+..+..+||+|.++|+.|.+|+++..|.+|+++++|+..+++.+|+++++|+
T Consensus         4 m~i~v~~k~vpd~~~~~~~~~~~ilv~~e~~~~~l~~~~~eal~~A~~la~~~~g~~v~av~~G~~~~~~~~~~~~a~Ga   83 (226)
T 1efv_B            4 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGA   83 (226)
T ss_dssp             CEEEEECCEEECTTSCCCBCTTSSSBCCTTCCEEECHHHHHHHHHHHHHHHTTSCSEEEEEEEESTTHHHHHHHHHHHTC
T ss_pred             CEEEEEEEECCCCCCEEEEECCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             78999978776888613892899949727987567841189999999988757993899999793899999999997179


Q ss_pred             CCCEEEECCC----CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEE
Q ss_conf             7623763365----478899999999986126864999961135888612899999985796133244334328659999
Q gi|254780368|r   81 DRGILIESNE----TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVT  156 (249)
Q Consensus        81 D~ai~i~d~~----~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~  156 (249)
                      |+++++++++    ..|++.+|++|++++++.+||+||||.+|.|+++|+++++||++||||+++++.++++++++++++
T Consensus        84 d~v~~~~~~~~~~~~~d~~~~A~~l~~~i~~~~p~~Il~g~~s~g~~~~~va~~lA~~L~~~~vs~v~~i~~~~g~~~~~  163 (226)
T 1efv_B           84 DRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVE  163 (226)
T ss_dssp             SEEEEEECCHHHHTTCCHHHHHHHHHHHHHHHTCSEEEEESCCTTTCCCCHHHHHHHHHTCCEEEEEEEEEEETTEEEEE
T ss_pred             CEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEEEECCEEEEE
T ss_conf             98999934534666406999999999998744999999945137898585999999984987243589999979999999


Q ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCCCCCEEEEE
Q ss_conf             835896799996398899984355654546988899885216612049890766668457999
Q gi|254780368|r  157 REVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLR  219 (249)
Q Consensus       157 r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~  219 (249)
                      |..++|.+.+++++||++|+..+.++||+|+++++|++++++|+.+++++++.+....+++++
T Consensus       164 r~~~~G~~~~~v~~P~vitv~~~~~~pr~~~~~~~~~a~~~~i~~~~~~~~~~~~~~~v~~vS  226 (226)
T 1efv_B          164 REIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVIS  226 (226)
T ss_dssp             EEETTEEEEEEEESSEEEEECGGGCCCCCCCHHHHHHTTTSCEEEECHHHHTCCCCCSEEEEE
T ss_pred             EECCCEEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEECHHHCCCCCCCCCEEEE
T ss_conf             984890999997499999998998867889978999747798508689993987789737999



>1efp_B (B:1-223) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} Back     alignment and structure
>1o97_C (C:1-228) Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} Back     alignment and structure
>1o97_D (D:1-188) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} Back     alignment and structure
>3fet_A (A:) Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Back     alignment and structure
>1efv_A (A:1-183) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} Back     alignment and structure
>1efp_A (A:1-179) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} Back     alignment and structure
>3ih5_A (A:1-122,A:163-217) Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dlo_A (A:) Universal stress protein; unknown function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.97A {Archaeoglobus fulgidus} Back     alignment and structure
>2z08_A (A:) Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} Back     alignment and structure
>1mjh_A (A:) Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fg9_A (A:14-156) Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>2pfs_A (A:) USP, universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.25A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2dum_A (A:) Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A, structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3fdx_A (A:) Putative filament protein / universal stress protein F; structural genomics, APC60640.1, PSI-2, protein structure initiative; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>2gm3_A (A:) Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP, protein structure initiative; HET: MSE AMP; 2.46A {Arabidopsis thaliana} Back     alignment and structure
>1q77_A (A:) Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} Back     alignment and structure