254780369

254780369

Electron transfer flavoprotein alpha subunit

GeneID in NCBI database:8209354Locus tag:CLIBASIA_01270
Protein GI in NCBI database:254780369Protein Accession:YP_003064782.1
Gene range:+(266994, 267950)Protein Length:318aa
Gene description:Electron transfer flavoprotein alpha subunit
COG prediction:[C] Electron transfer flavoprotein, alpha subunit
KEGG prediction:etfA; electron transfer flavoprotein alpha subunit; K03522 electron transfer flavoprotein alpha subunit
SEED prediction:Electron transfer flavoprotein, alpha subunit
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
ccccccEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccccEEEEEccHHHcccccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEccccEEEEEEEccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEcccccccccHHHccEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHccccccHHEEcccccEEcccEEEEEEEccHHHHHHccccccEEEEEEccccccEEEcccEEEEHHHHHHHHHHHHcc
ccccccEEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccccEEEEEccHHHHHcccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccEEEEcEEEEccEEEEEEccccEEEEEEEccccEEEEEcHHHcccccccccccEEEEcccccccccccEEEEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccEEEEcHHHHHcccccHHHEEccccEcccccEEEEEcccccHHHHcccccccEEEEEEcccccHHHHcccEEEEccHHHHHHHHHHHc
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIfrhklagpvsDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIispkifkrpsytgniiqtiettdtyQIITIRaiafppapkaeKVASIHKISAEVLEKYISNTRFIkeertslsptdlssaKIVIsggksfgsmENFHKLLLPLAKKLGAAIGatrdavdagfapndwqigqtgvtvspELYIAAGISGAIQhisgmkdsKVIVSIntdenapifkisdyfivgDIFKILPEIEKNL
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTifrhklagpvSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEiispkifkrpsytGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKeertslsptdlssaKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHklllplakklgaaIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
****DMP*LLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAF*****************EVLEKYISN**F***********DLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPP********SIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
**YCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL
MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
315121837318 Electron transfer flavoprotein alpha subunit [Candidatu 1 1e-141
209552153310 electron transfer flavoprotein subunit alpha [Rhizobium 1 6e-93
332186663310 electron transfer flavoFAD-binding domain protein [Sphi 1 3e-91
121602250309 electron transfer flavoprotein, alpha subunit [Bartonel 1 8e-91
227823221309 electron transfer flavoprotein, alpha subunit [Sinorhiz 1 3e-90
227822588310 electron transfer flavoprotein, alpha subunit [Sinorhiz 1 3e-90
209546973309 electron transfer flavoprotein subunit alpha [Rhizobium 1 1e-89
209551138309 electron transfer flavoprotein subunit alpha [Rhizobium 1 2e-89
86359376309 electron-transport flavoprotein, alpha-subunit [Rhizobi 1 2e-89
240850512306 electron transfer flavoprotein alpha subunit [Bartonell 1 2e-89
>gi|315121837|ref|YP_004062326.1| Electron transfer flavoprotein alpha subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 318 Back     alignment and organism information
 Score =  504 bits (1298), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 242/318 (76%), Positives = 277/318 (87%)

Query: 1   MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVT 60
           M YC+MPVL+LADYNQE LS QT RI+TAAQKI  DIHVLV+GDNIEN+A+QAA+I GVT
Sbjct: 1   MAYCNMPVLVLADYNQETLSPQTPRIITAAQKIGRDIHVLVIGDNIENVARQAAKIHGVT 60

Query: 61  QVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVI 120
           +VIVAQS +F H+L  P+SDF+VSIA+DY TIMA+ NA+GKD+LPRVAA+LDVMQVSEVI
Sbjct: 61  KVIVAQSAVFCHQLTSPLSDFIVSIAKDYGTIMAATNAIGKDVLPRVAAILDVMQVSEVI 120

Query: 121 EIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKY 180
           EI+SPK FKRP + GNIIQTIETTD YQ+ITIR  AFPPAP  +  A I K+++E LEK 
Sbjct: 121 EILSPKTFKRPMHAGNIIQTIETTDPYQVITIRTAAFPPAPLGKTTAYIQKVASEDLEKI 180

Query: 181 ISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAV 240
           I  +RFIK+  T     DLSSAKIV+SGGK+ GSMENFHKL+LPLA+KLGAA+GATRDAV
Sbjct: 181 IPTSRFIKKGTTIPGQIDLSSAKIVVSGGKALGSMENFHKLILPLAQKLGAAVGATRDAV 240

Query: 241 DAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISD 300
           DAGFAPNDWQ+GQTGVTVSP+LYIAAGISGAIQHISGM  SKVIVSIN DENAPI KISD
Sbjct: 241 DAGFAPNDWQVGQTGVTVSPDLYIAAGISGAIQHISGMNKSKVIVSINKDENAPILKISD 300

Query: 301 YFIVGDIFKILPEIEKNL 318
           YFIVGDIF+ILPEI+KNL
Sbjct: 301 YFIVGDIFEILPEIKKNL 318


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209552153|ref|YP_002284069.1| electron transfer flavoprotein subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 310 Back     alignment and organism information
>gi|332186663|ref|ZP_08388406.1| electron transfer flavoFAD-binding domain protein [Sphingomonas sp. S17] Length = 310 Back     alignment and organism information
>gi|121602250|ref|YP_989313.1| electron transfer flavoprotein, alpha subunit [Bartonella bacilliformis KC583] Length = 309 Back     alignment and organism information
>gi|227823221|ref|YP_002827193.1| electron transfer flavoprotein, alpha subunit [Sinorhizobium fredii NGR234] Length = 309 Back     alignment and organism information
>gi|227822588|ref|YP_002826560.1| electron transfer flavoprotein, alpha subunit [Sinorhizobium fredii NGR234] Length = 310 Back     alignment and organism information
>gi|209546973|ref|YP_002278891.1| electron transfer flavoprotein subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 309 Back     alignment and organism information
>gi|209551138|ref|YP_002283055.1| electron transfer flavoprotein subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 309 Back     alignment and organism information
>gi|86359376|ref|YP_471268.1| electron-transport flavoprotein, alpha-subunit [Rhizobium etli CFN 42] Length = 309 Back     alignment and organism information
>gi|240850512|ref|YP_002971911.1| electron transfer flavoprotein alpha subunit [Bartonella grahamii as4aup] Length = 306 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
COG2025313 COG2025, FixB, Electron transfer flavoprotein, alpha su 3e-76
PLN00022356 PLN00022, PLN00022, electron transfer flavoprotein subu 1e-75
PRK11916312 PRK11916, PRK11916, electron transfer flavoprotein subu 1e-22
KOG3954336 KOG3954, KOG3954, KOG3954, Electron transfer flavoprote 9e-83
pfam0076686 pfam00766, ETF_alpha, Electron transfer flavoprotein FA 2e-33
cd01715168 cd01715, ETF_alpha, The electron transfer flavoprotein 5e-33
cd01985181 cd01985, ETF, The electron transfer flavoprotein (ETF) 2e-22
pfam01012161 pfam01012, ETF, Electron transfer flavoprotein domain 1e-21
PRK03363313 PRK03363, fixB, putative electron transfer flavoprotein 1e-22
>gnl|CDD|32208 COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177660 PLN00022, PLN00022, electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|183380 PRK11916, PRK11916, electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>gnl|CDD|39157 KOG3954, KOG3954, KOG3954, Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|144387 pfam00766, ETF_alpha, Electron transfer flavoprotein FAD-binding domain Back     alignment and domain information
>gnl|CDD|30170 cd01715, ETF_alpha, The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>gnl|CDD|30172 cd01985, ETF, The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>gnl|CDD|144557 pfam01012, ETF, Electron transfer flavoprotein domain Back     alignment and domain information
>gnl|CDD|179570 PRK03363, fixB, putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 318 Electron transfer flavoprotein alpha subunit [Candidatu
COG2025313 FixB Electron transfer flavoprotein, alpha subunit [Ene 100.0
PRK11916312 electron transfer flavoprotein subunit YdiR; Provisiona 100.0
PRK03363313 fixB putative electron transfer flavoprotein FixB; Prov 100.0
KOG3954336 consensus 100.0
PRK08155 564 acetolactate synthase catalytic subunit; Validated 96.87
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 96.61
cd01715168 ETF_alpha The electron transfer flavoprotein (ETF) serv 100.0
pfam01012161 ETF Electron transfer flavoprotein domain. This family 99.97
cd01985181 ETF The electron transfer flavoprotein (ETF) serves as 99.95
PRK12342254 putative electron transfer flavoprotein YdiQ; Provision 99.05
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) serve 98.86
COG2086260 FixA Electron transfer flavoprotein, beta subunit [Ener 98.69
PRK03359256 putative electron transfer flavoprotein FixA; Reviewed 98.64
KOG3180254 consensus 96.27
pfam0076686 ETF_alpha Electron transfer flavoprotein FAD-binding do 100.0
PRK08322 547 acetolactate synthase; Reviewed 97.42
PRK09124 574 pyruvate dehydrogenase; Provisional 97.33
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validated 97.33
pfam00205138 TPP_enzyme_M Thiamine pyrophosphate enzyme, central dom 97.29
PRK08617 552 acetolactate synthase; Reviewed 97.27
PRK06048 562 acetolactate synthase 3 catalytic subunit; Reviewed 97.2
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validated 97.17
PRK06154 556 hypothetical protein; Provisional 97.1
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewed 97.03
PRK11269 591 glyoxylate carboligase; Provisional 97.02
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 96.91
PRK07092 521 benzoylformate decarboxylase; Reviewed 96.88
PRK07525 589 sulfoacetaldehyde acetyltransferase; Validated 96.78
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 96.71
PRK07418 615 acetolactate synthase 3 catalytic subunit; Reviewed 96.68
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validated 96.67
PRK08611 576 pyruvate oxidase; Provisional 96.67
PRK06112 581 acetolactate synthase catalytic subunit; Validated 96.6
PRK08527 560 acetolactate synthase 3 catalytic subunit; Validated 96.54
PRK06546 578 pyruvate dehydrogenase; Provisional 96.37
PRK08327 568 acetolactate synthase catalytic subunit; Validated 96.3
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 96.29
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validated 96.28
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 96.24
CHL00099 588 ilvB acetohydroxyacid synthase large subunit 96.15
PRK07524 534 hypothetical protein; Provisional 96.1
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validated 96.03
PRK08266 531 hypothetical protein; Provisional 95.86
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validated 95.77
PRK08199 553 acetolactate synthase 2 catalytic subunit; Validated 95.72
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validated 95.62
PRK09107 594 acetolactate synthase 3 catalytic subunit; Validated 95.56
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number of ba 95.33
PRK09259 572 putative oxalyl-CoA decarboxylase; Validated 95.05
PRK06457 549 pyruvate dehydrogenase; Provisional 94.58
PRK08273 597 pyruvate decarboxylase; Provisional 94.18
PRK05858 543 hypothetical protein; Provisional 93.96
PRK07064 544 hypothetical protein; Provisional 90.59
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [acetolac 95.98
PRK00481239 NAD-dependent deacetylase; Provisional 95.44
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which includes h 94.35
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and 94.22
PRK05333285 NAD-dependent deacetylase; Provisional 92.15
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>KOG3954 consensus Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>pfam01012 ETF Electron transfer flavoprotein domain Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PRK12342 putative electron transfer flavoprotein YdiQ; Provisional Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>KOG3180 consensus Back     alignment and domain information
>pfam00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>pfam00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08199 acetolactate synthase 2 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08273 pyruvate decarboxylase; Provisional Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
1t9g_R333 Structure Of The Human Mcad:etf Complex Length = 33 1e-83
1efv_A315 Three-Dimensional Structure Of Human Electron Trans 5e-83
1efp_A307 Electron Transfer Flavoprotein (Etf) From Paracoccu 2e-63
1o94_D320 Ternary Complex Between Trimethylamine Dehydrogenas 2e-51
3clu_D321 Crystal Structure Of The R236k Mutant From Methylop 8e-51
3clt_D321 Crystal Structure Of The R236e Mutant Of Methylophi 2e-50
3clr_D321 Crystal Structure Of The R236a Etf Mutant From M. M 4e-50
3cls_D321 Crystal Structure Of The R236c Mutant Of Etf From M 4e-50
3ih5_A217 Crystal Structure Of Electron Transfer Flavoprotein 1e-12
gi|49259285|pdb|1T9G|R Chain R, Structure Of The Human Mcad:etf Complex Length = 333 Back     alignment and structure
 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 198/314 (63%), Gaps = 6/314 (1%)

Query: 7   PVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQ 66
             L++A++  ++L+  T   +TAA ++  ++  LV G   + +AQ   ++ G+ +V+VAQ
Sbjct: 21  STLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQ 80

Query: 67  STIFRHKLAGPVSDFV--VSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIIS 124
             +++  L   ++  +       +Y  I A A+A GK++LPRVAA L+V  +S++I I S
Sbjct: 81  HDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKS 140

Query: 125 PKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNT 184
           P  F R  Y GN + T++  +  ++ ++R  +F  A  +   AS  K S       +  +
Sbjct: 141 PDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKAS---STSPVEIS 197

Query: 185 RFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGF 244
            ++ ++ T     +L+ AK+V+SGG+   S ENF KLL  LA +L AA+GA+R AVDAGF
Sbjct: 198 EWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENF-KLLYDLADQLHAAVGASRAAVDAGF 256

Query: 245 APNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIV 304
            PND Q+GQTG  V+PELYIA GISGAIQH++GMKDSK IV+IN D  APIF+++DY IV
Sbjct: 257 VPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIV 316

Query: 305 GDIFKILPEIEKNL 318
            D+FK++PE+ + L
Sbjct: 317 ADLFKVVPEMTEIL 330


>gi|2781202|pdb|1EFV|A Chain A, Three-Dimensional Structure Of Human Electron Transfer Flavoprotein To 2.1 A Resolution Length = 315 Back     alignment and structure
>gi|5822051|pdb|1EFP|A Chain A, Electron Transfer Flavoprotein (Etf) From Paracoccus Denitrificans Length = 307 Back     alignment and structure
>gi|28949075|pdb|1O94|D Chain D, Ternary Complex Between Trimethylamine Dehydrogenase And Electron Transferring Flavoprotein Length = 320 Back     alignment and structure
>gi|178847588|pdb|3CLU|D Chain D, Crystal Structure Of The R236k Mutant From Methylophilus Methylotrophus Etf Length = 321 Back     alignment and structure
>gi|178847586|pdb|3CLT|D Chain D, Crystal Structure Of The R236e Mutant Of Methylophilus Methylotrophus Etf Length = 321 Back     alignment and structure
>gi|178847582|pdb|3CLR|D Chain D, Crystal Structure Of The R236a Etf Mutant From M. Methylotrophus Length = 321 Back     alignment and structure
>gi|178847584|pdb|3CLS|D Chain D, Crystal Structure Of The R236c Mutant Of Etf From Methylophilus Methylotrophus Length = 321 Back     alignment and structure
>gi|257472012|pdb|3IH5|A Chain A, Crystal Structure Of Electron Transfer Flavoprotein Alpha- Subunit From Bacteroides Thetaiotaomicron Length = 217 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
1efp_A307 ETF, protein (electron transfer flavoprotein); electron 1e-76
1efv_A315 Electron transfer flavoprotein; electron transport, glu 6e-74
1o97_D320 Electron transferring flavoprotein alpha-subunit; FAD b 6e-59
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alpha-bet 2e-18
3fet_A166 Electron transfer flavoprotein subunit alpha related pr 6e-16
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Length = 307 Back     alignment and structure
 Score =  282 bits (722), Expect = 1e-76
 Identities = 137/311 (44%), Positives = 199/311 (63%), Gaps = 5/311 (1%)

Query: 8   VLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQS 67
           VLLL +     L+        AA K   D+ VL  G + +  A++AA+I GV +V+VA+ 
Sbjct: 2   VLLLGEVTNGALNRDATAKAVAAVKALGDVTVLCAGASAKAAAEEAAKIAGVAKVLVAED 61

Query: 68  TIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKI 127
            ++ H+LA P +  +V +A DY  I A A    K+++PRVAA+LDVM +S+V  I+    
Sbjct: 62  ALYGHRLAEPTAALIVGLAGDYSHIAAPATTDAKNVMPRVAALLDVMVLSDVSAILDADT 121

Query: 128 FKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLEKYISNTRFI 187
           F+RP Y GN IQ +++ D  ++ TIR  +F  A +          +A         + ++
Sbjct: 122 FERPIYAGNAIQVVKSKDAKKVFTIRTASFDAAGEGGTAPVTETAAA----ADPGLSSWV 177

Query: 188 KEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPN 247
            +E       +L+SA+ V+SGG+  GS E+F  ++  LA KLGAA+GA+R AVD+G+APN
Sbjct: 178 ADEVAESDRPELTSARRVVSGGRGLGSKESF-AIIEELADKLGAAVGASRAAVDSGYAPN 236

Query: 248 DWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDI 307
           DWQ+GQTG  V+PELY+A GISGAIQH++GMKDSKVIV+IN DE APIF+I+DY +VGD+
Sbjct: 237 DWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQIADYGLVGDL 296

Query: 308 FKILPEIEKNL 318
           F ++PE+   L
Sbjct: 297 FSVVPELTGKL 307


>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Length = 315 Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Length = 320 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Length = 217 Back     alignment and structure
>3fet_A Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Length = 166 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
1efv_A315 Electron transfer flavoprotein; electron transport, glu 100.0
1o97_D320 Electron transferring flavoprotein alpha-subunit; FAD b 100.0
1efp_A307 ETF, protein (electron transfer flavoprotein); electron 100.0
2ez9_A 603 Pyruvate oxidase; TPP enzyme, reaction intermediate ana 95.55
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta 95.54
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyacid sy 92.53
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alpha-bet 100.0
3fet_A166 Electron transfer flavoprotein subunit alpha related pr 99.94
1efv_B255 Electron transfer flavoprotein; electron transport, glu 98.98
1efp_B252 ETF, protein (electron transfer flavoprotein); electron 98.62
1o97_C264 Electron transferring flavoprotein beta-subunit; FAD bi 98.78
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondrial; NAD 96.12
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1 96.09
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SIR2 ho 95.94
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 fami 95.9
2b4y_A271 NAD-dependent deacetylase sirtuin-5; histone deacetylas 95.67
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50A {Sa 95.08
1m2k_A249 Silent information regulator 2; protein-ligand complex, 95.07
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, sirtui 94.96
1q1a_A289 HST2 protein; ternary complex, histone deacetylase, 2'- 94.88
3k35_A318 Mono-ADP-ribosyltransferase sirtuin-6; rossmann fold, Z 94.67
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing; gene regulation 91.2
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxyacid 95.69
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, 94.59
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradation, t 94.25
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP), thi 93.53
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate comp 92.24
3cf4_G170 Acetyl-COA decarbonylase/synthase epsilon subunit; meth 91.84
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-car 91.43
2ixd_A242 LMBE-related protein; hexamer, deacetylase, rossman fol 93.86
1uan_A227 Hypothetical protein TT1542; rossmann-like, structural 91.76
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
Probab=100.00  E-value=0  Score=695.06  Aligned_cols=309  Identities=41%  Similarity=0.702  Sum_probs=286.1

Q ss_pred             EEEEEEEEECCCEECHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             34899998029758789999999998738934799981892688899870789739999448101000123224557874
Q gi|254780369|r    6 MPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSI   85 (318)
Q Consensus         6 M~ilV~~E~~~g~l~~~slEll~~A~~lg~~v~avv~G~~~~~~a~~~~~~~Gad~V~~~~~~~~~~~~~~~~a~~l~~~   85 (318)
                      |++|||+||+||+|++.|+|++++||+||++++++++|.+.+..+.++++++|+|+||.++++.|..|.++.|+++++++
T Consensus         2 ~s~LV~aE~~~g~l~~~s~Ell~~A~~Lg~~v~avv~G~~~~~~a~~l~~~~Gad~V~~~~~~~~~~~~~e~~a~al~~~   81 (315)
T 1efv_A            2 QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILAT   81 (315)
T ss_dssp             CEEEEECCEETTEECTHHHHHHHHHHTTTSEEEEEEEESCCHHHHHHHHHSTTCCEEEEEECGGGTTCCHHHHHHHHHHH
T ss_pred             CEEEEEEEECCCEECHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             41899999479999999999999999858974899988880899999851369878999458202035603457899888


Q ss_pred             CC--CCCEEECCCCCHHHHHHHHHHHHCCCCEECCCEEECCCCEEEEEEECCCEEEEEEECCCCEEEEECCCCCCCCCCC
Q ss_conf             03--4560441578103446788887517741013202246872797410695268999779842799516864333355
Q gi|254780369|r   86 AR--DYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKA  163 (318)
Q Consensus        86 ~~--~~~~Vl~~~t~~GrdlaprlAarL~~~~vsdvv~i~~~~~~~rp~fgG~~~a~v~~~~~~~viTvr~~sf~~~~~~  163 (318)
                      ++  +|++||+|+|++||||+||||+||++++++||++++.+..++||+|+|+.++++++...++++|+|+++|++.+..
T Consensus        82 ~~~~~p~~VL~~~T~~GrdlaprLAarL~~g~vsdv~~l~~~~~~~r~~~~g~~~~~~~~~~~~~~~tvr~~~f~~~~~~  161 (315)
T 1efv_A           82 QKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATS  161 (315)
T ss_dssp             HHHHCCSEEEEESSHHHHHHHHHHHHHHTCCCEEEECEEEETTEEEEEETTTTEEEEEEECCSSEEEEECGGGSCCCCSS
T ss_pred             HHHCCCCEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCEEEEEEECCCCEEEEEECCCCEEEEECCCCCCCCCCC
T ss_conf             75148548996377436678999999809971516899945995999997453179996247614887415643454455


Q ss_pred             CCCCCEEEEECCCCCCCCEEEEEEEEEECCCCCCCHHHCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEHHHHHCC
Q ss_conf             66666156211102445302588544431456667000745641367777833568899999876398597425788678
Q gi|254780369|r  164 EKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAG  243 (318)
Q Consensus       164 ~~~~~v~~~~~~~~~~~~~~~~~i~~~~~~~~~v~L~~A~iVVsgGRGi~~~enf~~l~~~LA~~LgaavG~SRp~vD~g  243 (318)
                      ......... ...  ......+.++.......+++|++|++|||+|||++++||| +++++||++|||++|||||+||+|
T Consensus       162 ~~~~~~~~~-~~~--~~~~~~~~~~~~~~~~~~~~L~~A~vVVs~GrG~~~~e~~-~~~~eLA~~LgaavGaSR~~vD~G  237 (315)
T 1efv_A          162 GGSASSEKA-SST--SPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENF-KLLYDLADQLHAAVGASRAAVDAG  237 (315)
T ss_dssp             SCCCEEEEC-CCC--CCCCSEEEEEEEECCCCSCCGGGCSEEEEECGGGCSTGGG-HHHHHHHHHHTCEEEECHHHHHTT
T ss_pred             CCCCEEEEC-CCC--CCCCCEEEEEEEECCCCCCCCCCCEEEEECCCCCCCCHHH-HHHHHHHHHHCCCEEEEHHHHHCC
T ss_conf             687505750-346--7631101111221123665434415999658755671356-679999998568678712675489


Q ss_pred             CCCHHHHHHCCCCEECCCEEEEEEECCHHHHHHHHCCCCEEEEEECCCCCCHHHCCCEEEECCHHHHHHHHHHCC
Q ss_conf             888889540159754573899996167264555516898899976659988310276457523899999988609
Q gi|254780369|r  244 FAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL  318 (318)
Q Consensus       244 w~p~~~qIG~tG~~v~P~lYia~GISGa~qH~~G~~~s~~IvAIN~D~~ApIf~~ad~giv~D~~~vlp~l~~~l  318 (318)
                      |+||++||||||++|+|+||||||||||+||++||++|++||||||||+||||++||||||||+++|||+|+|+|
T Consensus       238 w~p~~~qIGqtG~~v~P~lYia~GISGa~qH~~G~~~s~~IvAIN~D~~ApIf~~aD~giVgD~~~vlp~l~e~l  312 (315)
T 1efv_A          238 FVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL  312 (315)
T ss_dssp             SSCGGGBBSTTSBCCCCSEEEEESCCCCHHHHTTTTTCSEEEEEESCTTCGGGGTCSEEEESCHHHHHHHHHHHT
T ss_pred             CCCCCCEEECCCEECCCCEEEEEECCCHHHHHHHHCCCCEEEEEECCCCCCCHHHCCEEEECCHHHHHHHHHHHH
T ss_conf             998000870687686777699970477088887523598899983899998431289899760999999999998



>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>2ez9_A Pyruvate oxidase; TPP enzyme, reaction intermediate analogue, oxidoreductase; HET: TDK FAD; 1.60A {Lactobacillus plantarum} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1y9d_A* 1pow_A* 1pox_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fet_A Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondrial; NAD dependent deacetylase, sirtuin, substrate peptide complex, hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>2b4y_A NAD-dependent deacetylase sirtuin-5; histone deacetylase, structural genomics, structural genomics consortium, SGC, hydrolase; HET: APR EPE; 1.90A {Homo sapiens} SCOP: c.31.1.5 PDB: 2nyr_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>3k35_A Mono-ADP-ribosyltransferase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, structural genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, enzyme, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarbonylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductase; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2ixd_A LMBE-related protein; hexamer, deacetylase, rossman fold, zinc-dependent metalloenzyme, hydrolase; 1.8A {Bacillus cereus} Back     alignment and structure
>1uan_A Hypothetical protein TT1542; rossmann-like, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.00A {Thermus thermophilus} SCOP: c.134.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 Electron transfer flavoprotein alpha subunit [Candidatu
d1efva2124 c.31.1.2 (A:208-331) C-terminal domain of the electron 1e-39
d3clsd2123 c.31.1.2 (D:196-318) C-terminal domain of the electron 8e-38
d1efva1188 c.26.2.3 (A:20-207) Large, alpha subunit of electron tr 3e-28
d1efpa1183 c.26.2.3 (A:2-184) Large, alpha subunit of electron tra 1e-27
d3clsd1192 c.26.2.3 (D:1-192) Large, alpha subunit of electron tra 2e-19
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: C-terminal domain of the electron transfer flavoprotein alpha subunit
domain: C-terminal domain of the electron transfer flavoprotein alpha subunit
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  157 bits (398), Expect = 1e-39
 Identities = 76/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (0%)

Query: 198 DLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVT 257
           +L+ AK+V+SGG+   S ENF KLL  LA +L AA+GA+R AVDAGF PND Q+GQTG  
Sbjct: 4   ELTGAKVVVSGGRGLKSGENF-KLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKI 62

Query: 258 VSPELYIAAGISGAIQHISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKN 317
           V+PELYIA GISGAIQH++GMKDSK IV+IN D  APIF+++DY IV D+FK++PE+ + 
Sbjct: 63  VAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEI 122

Query: 318 L 318
           L
Sbjct: 123 L 123


>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Length = 123 Back     information, alignment and structure
>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 188 Back     information, alignment and structure
>d1efpa1 c.26.2.3 (A:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Length = 183 Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Length = 192 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
d1efva2124 C-terminal domain of the electron transfer flavoprotein 100.0
d3clsd2123 C-terminal domain of the electron transfer flavoprotein 100.0
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker's ye 98.19
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590] 98.09
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumoniae 98.06
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId 97.74
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} 97.61
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale cres 97.54
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [TaxId 97.51
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavuligeru 97.38
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} 95.11
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon subun 94.71
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyces ce 94.23
d1efva1188 Large, alpha subunit of electron transfer flavoprotein 100.0
d1efpa1183 Large, alpha subunit of electron transfer flavoprotein 100.0
d3clsd1192 Large, alpha subunit of electron transfer flavoprotein 100.0
d1efvb_252 Small, beta subunit of electron transfer flavoprotein E 98.75
d1efpb_246 Small, beta subunit of electron transfer flavoprotein E 98.7
d3clsc1262 Small, beta subunit of electron transfer flavoprotein E 98.75
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritima [Ta 96.25
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [TaxId 95.8
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo sapien 95.59
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus 95.42
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobu 95.01
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 94.59
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 94.44
d1uana_227 Hypothetical protein TT1542 {Thermus thermophilus [TaxI 93.13
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: C-terminal domain of the electron transfer flavoprotein alpha subunit
domain: C-terminal domain of the electron transfer flavoprotein alpha subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=397.15  Aligned_cols=123  Identities=62%  Similarity=0.982  Sum_probs=120.5

Q ss_pred             CCCCHHHCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEHHHHHCCCCCHHHHHHCCCCEECCCEEEEEEECCHHHH
Q ss_conf             66670007456413677778335688999998763985974257886788888895401597545738999961672645
Q gi|254780369|r  195 SPTDLSSAKIVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQH  274 (318)
Q Consensus       195 ~~v~L~~A~iVVsgGRGi~~~enf~~l~~~LA~~LgaavG~SRp~vD~gw~p~~~qIG~tG~~v~P~lYia~GISGa~qH  274 (318)
                      +++||++|++|||+|||++++||| +++++||++|||++|||||+||.||+|++|||||||++|+|+||||||||||+||
T Consensus         1 ~r~dl~~A~ivV~~GrG~~~~e~~-~~~~~lA~~lga~vg~SR~~vd~gw~~~~~qIG~SG~~V~P~lyia~GISGa~QH   79 (124)
T d1efva2           1 DRPELTGAKVVVSGGRGLKSGENF-KLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQH   79 (124)
T ss_dssp             CSCCGGGCSEEEEECGGGCSTGGG-HHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBSTTSBCCCCSEEEEESCCCCHHH
T ss_pred             CCCCCCCCCEEEECCCCCCCHHHH-HHHHHHHHHHCCEEEEEEHHHHCCCCCCCEEECCCCEEECCCEEEEECCHHHHHH
T ss_conf             987766799999879876887888-9999999984886467535665777550006403642857858999642667777


Q ss_pred             HHHHCCCCEEEEEECCCCCCHHHCCCEEEECCHHHHHHHHHHCC
Q ss_conf             55516898899976659988310276457523899999988609
Q gi|254780369|r  275 ISGMKDSKVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL  318 (318)
Q Consensus       275 ~~G~~~s~~IvAIN~D~~ApIf~~ad~giv~D~~~vlp~l~~~l  318 (318)
                      ++||++|++|||||+||+||||++||||||||++||||+|+|+|
T Consensus        80 ~~Gi~~s~~IvAIN~D~~ApIf~~aD~giVgD~~evlp~L~e~l  123 (124)
T d1efva2          80 LAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL  123 (124)
T ss_dssp             HTTTTTCSEEEEEESCTTCGGGGTCSEEEESCHHHHHHHHHHHT
T ss_pred             HHHCCCCCEEEEEECCCCCCCCCCCCEEEECCHHHHHHHHHHHH
T ss_conf             86515798899981899998400078788660999999999974



>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efpa1 c.26.2.3 (A:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 Electron transfer flavoprotein alpha subunit [Cand
1efv_A_1-183183 (A:1-183) Electron transfer flavoprotein; electron 1e-24
1efp_A_1-179179 (A:1-179) ETF, protein (electron transfer flavopro 5e-23
1o97_D_1-188188 (D:1-188) Electron transferring flavoprotein alpha 2e-20
3fet_A_166 (A:) Electron transfer flavoprotein subunit alpha 1e-14
1efp_B_1-223223 (B:1-223) ETF, protein (electron transfer flavopro 1e-13
1o97_C_1-228228 (C:1-228) Electron transferring flavoprotein beta- 3e-13
1efv_B_1-226226 (B:1-226) Electron transfer flavoprotein; electron 9e-13
1efv_A_184-315132 (A:184-315) Electron transfer flavoprotein; electr 2e-18
1efp_A_180-307128 (A:180-307) ETF, protein (electron transfer flavop 2e-18
1o97_D_189-320132 (D:189-320) Electron transferring flavoprotein alp 6e-17
3ih5_A_1-122_163-217177 (A:1-122,A:163-217) Electron transfer flavoprotein 5e-15
>1efv_A (A:1-183) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 183 Back     alignment and structure
 Score =  108 bits (271), Expect = 1e-24
 Identities = 51/175 (29%), Positives = 98/175 (56%), Gaps = 2/175 (1%)

Query: 6   MPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVA 65
              L++A++  ++L+  T   +TAA ++  ++  LV G   + +AQ   ++ G+ +V+VA
Sbjct: 2   QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVA 61

Query: 66  QSTIFRHKLAGPVSDFVVSIAR--DYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEII 123
           Q  +++  L   ++  +++  +  +Y  I A A+A GK++LPRVAA L+V  +S++I I 
Sbjct: 62  QHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIK 121

Query: 124 SPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKAEKVASIHKISAEVLE 178
           SP  F R  Y GN + T++  +  ++ ++R  +F  A  +   AS  K S+    
Sbjct: 122 SPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKASSTSPV 176


>1efp_A (A:1-179) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 179 Back     alignment and structure
>1o97_D (D:1-188) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus}Length = 188 Back     alignment and structure
>3fet_A (A:) Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum}Length = 166 Back     alignment and structure
>1efp_B (B:1-223) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 223 Back     alignment and structure
>1o97_C (C:1-228) Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus}Length = 228 Back     alignment and structure
>1efv_B (B:1-226) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 226 Back     alignment and structure
>1efv_A (A:184-315) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 132 Back     alignment and structure
>1efp_A (A:180-307) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 128 Back     alignment and structure
>1o97_D (D:189-320) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus}Length = 132 Back     alignment and structure
>3ih5_A (A:1-122,A:163-217) Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron}Length = 177 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 Electron transfer flavoprotein alpha subunit [Candidatu
1efv_A_1-183183 Electron transfer flavoprotein; electron transport 100.0
1efp_A_1-179179 ETF, protein (electron transfer flavoprotein); ele 100.0
1o97_D_1-188188 Electron transferring flavoprotein alpha-subunit; 99.97
1o97_C_1-228228 Electron transferring flavoprotein beta-subunit; F 99.96
1efp_B_1-223223 ETF, protein (electron transfer flavoprotein); ele 99.94
1efv_B_1-226226 Electron transfer flavoprotein; electron transport 99.92
3fet_A_166 Electron transfer flavoprotein subunit alpha relat 99.92
3ih5_A_1-122_163-217177 Electron transfer flavoprotein alpha-subunit; alph 99.91
1o97_D_189-320132 Electron transferring flavoprotein alpha-subunit; 99.6
1efp_A_180-307128 ETF, protein (electron transfer flavoprotein); ele 99.52
1efv_A_184-315132 Electron transfer flavoprotein; electron transport 99.26
1q6z_A_174-341168 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 98.31
2q28_A_192-368177 Oxalyl-COA decarboxylase; lyase, oxalate degradati 98.29
1t9b_A_259-455197 Acetolactate synthase, mitochondrial; acetohydroxy 98.22
3eya_A_175-354180 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 98.21
2ez9_A_189-368_555-603229 Pyruvate oxidase; TPP enzyme, reaction intermediat 98.03
1ozh_A_187-366180 ALS, acetolactate synthase, catabolic; acetohydrox 97.9
3hww_A_196-343148 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 97.66
2c31_A_194-372179 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 97.5
2iht_A_187-356170 Carboxyethylarginine synthase; thiamin diphosphate 97.48
2pgn_A_183-372190 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 97.47
3cf4_G_170 Acetyl-COA decarbonylase/synthase epsilon subunit; 97.33
1v5e_A_183-361_548-590222 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 97.23
1ovm_A_181-349169 Indole-3-pyruvate decarboxylase; thiamine diphosph 97.16
2uz1_A_182-367186 Benzaldehyde lyase; thiamine diphosphate, thiamine 97.06
1ytl_A_174 Acetyl-COA decarbonylase/synthase complex epsilon 96.96
2pan_A_205-389_582-616220 Glyoxylate carboligase; thiamin-diphosphate (THDP) 96.83
1ybh_A_199-372174 Acetolactate synthase, chloroplast; acetohydroxyac 96.25
2wvg_A_181-357177 PDC, pyruvate decarboxylase; thiamine diphosphate, 95.72
2vk8_A_186-350165 Pyruvate decarboxylase isozyme 1; asymmetric activ 95.53
3glr_A_1-40_108-133_189-264142 NAD-dependent deacetylase sirtuin-3, mitochondrial 95.11
2vbi_A_184-348165 Pyruvate decarboxylase; thiamine pyrophosphate, ly 94.41
2nxw_A_199-361163 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 94.31
2vbf_A_202-364163 Branched-chain alpha-ketoacid decarboxylase; KDCA, 91.49
1j8f_A_22-153_205-323251 SIRT2, sirtuin 2, isoform 1, silencing; gene regul 94.47
1s5p_A_235 NAD-dependent deacetylase; protein deacetylase, SI 93.6
1ma3_A_1-117_168-253203 SIR2-AF2, transcriptional regulatory protein, SIR2 93.42
2hjh_A_1-155_240-354270 NAD-dependent histone deacetylase SIR2; protein, s 92.76
1q14_A_1-138_191-361309 HST2 protein; histone deacetylase, hydrolase; 2.50 92.59
1m2k_A_249 Silent information regulator 2; protein-ligand com 91.72
3k35_A_318 Mono-ADP-ribosyltransferase sirtuin-6; rossmann fo 90.4
1uan_A_227 Hypothetical protein TT1542; rossmann-like, struct 90.15
>1efv_A (A:1-183) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.6e-34  Score=235.94  Aligned_cols=179  Identities=28%  Similarity=0.533  Sum_probs=162.7

Q ss_pred             EEEEEEEEECCCEECHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             34899998029758789999999998738934799981892688899870789739999448101000123224557874
Q gi|254780369|r    6 MPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSI   85 (318)
Q Consensus         6 M~ilV~~E~~~g~l~~~slEll~~A~~lg~~v~avv~G~~~~~~a~~~~~~~Gad~V~~~~~~~~~~~~~~~~a~~l~~~   85 (318)
                      |+||||+|+.++.|++.++|++++|++|++++.++++|.+..+.+.+.+..+|+|+||+++++.+..|+++.|++++.++
T Consensus         2 ~~ilV~~e~~~~~l~~~s~e~l~~A~~L~~~v~av~~G~~~~~~~~~~~~~~Gad~v~~v~~~~~~~~~~~~~a~al~~~   81 (183)
T 1efv_A            2 QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILAT   81 (183)
T ss_dssp             CEEEEECCEETTEECTHHHHHHHHHHTTTSEEEEEEEESCCHHHHHHHHHSTTCCEEEEEECGGGTTCCHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCEECHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEECCCHHCCCCHHHHHHHHHHH
T ss_conf             73799999259999889999999999858976999987870799999875159878999258301235778999999999


Q ss_pred             CC--CCCEEECCCCCHHHHHHHHHHHHCCCCEECCCEEECCCCEEEEEEECCCEEEEEEECCCCEEEEECCCCCCCCCCC
Q ss_conf             03--4560441578103446788887517741013202246872797410695268999779842799516864333355
Q gi|254780369|r   86 AR--DYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKA  163 (318)
Q Consensus        86 ~~--~~~~Vl~~~t~~GrdlaprlAarL~~~~vsdvv~i~~~~~~~rp~fgG~~~a~v~~~~~~~viTvr~~sf~~~~~~  163 (318)
                      ++  +|++||+++|.+||+++||||+||++++++||++++.+..++|++|+|+..+++...+.|+|+|+|+++|+|.+.+
T Consensus        82 i~~~~p~~Vl~~~s~~g~~la~~lA~~L~~~~vsdv~~~~~~~~~~r~~~~g~~~~~~~~~~~p~vitv~~~~~~p~~~~  161 (183)
T 1efv_A           82 QKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATS  161 (183)
T ss_dssp             HHHHCCSEEEEESSHHHHHHHHHHHHHHTCCCEEEECEEEETTEEEEEETTTTEEEEEEECCSSEEEEECGGGSCCCCSS
T ss_pred             HHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCEEEEEEECCCEEEEEECCCCCEEEEECCCCCCCCCCC
T ss_conf             87429989998887114567589998727761067589605883887775682699872489966999788764466667


Q ss_pred             CCCCCEEEEECCCCCCCCEEEEEE
Q ss_conf             666661562111024453025885
Q gi|254780369|r  164 EKVASIHKISAEVLEKYISNTRFI  187 (318)
Q Consensus       164 ~~~~~v~~~~~~~~~~~~~~~~~i  187 (318)
                      .+.++++.++.+.....   .+++
T Consensus       162 ~~~~~v~~~~~~~~~~~---~~vv  182 (183)
T 1efv_A          162 GGSASSEKASSTSPVEI---SEWL  182 (183)
T ss_dssp             SCCCEEEECCCCCCCCS---EEEE
T ss_pred             CCCCEEEECCCCCCCCC---EEEE
T ss_conf             89740574365677642---2555



>1efp_A (A:1-179) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} Back     alignment and structure
>1o97_D (D:1-188) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} Back     alignment and structure
>1o97_C (C:1-228) Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} Back     alignment and structure
>1efp_B (B:1-223) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} Back     alignment and structure
>1efv_B (B:1-226) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} Back     alignment and structure
>3fet_A (A:) Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum} Back     alignment and structure
>3ih5_A (A:1-122,A:163-217) Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o97_D (D:189-320) Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} Back     alignment and structure
>1efp_A (A:180-307) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} Back     alignment and structure
>1efv_A (A:184-315) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} Back     alignment and structure
>1q6z_A (A:174-341) BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, thiamin thiazolone diphosphate, inhibitor; HET: TZD; 1.00A {Pseudomonas putida} Back     alignment and structure
>2q28_A (A:192-368) Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiamine diphosphate; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>1t9b_A (A:259-455) Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3eya_A (A:175-354) Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back