254780370

254780370

argininosuccinate lyase

GeneID in NCBI database:8209355Locus tag:CLIBASIA_01275
Protein GI in NCBI database:254780370Protein Accession:YP_003064783.1
Gene range:+(268037, 269458)Protein Length:473aa
Gene description:argininosuccinate lyase
COG prediction:[E] Argininosuccinate lyase
KEGG prediction:argH; argininosuccinate lyase (EC:4.3.2.1); K01755 argininosuccinate lyase [EC:4.3.2.1]
SEED prediction:Argininosuccinate lyase (EC 4.3.2.1)
Pathway involved in KEGG:Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI
ccccccccHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcccccccccccccccHHHHHHHHcccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccHHHcEEcccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHcHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccc
mskkiksnevnqmwggrfssspswiMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEivdgsfvfsrdlEDIHMNIEARLTSLIGSIAgkmhtarsrNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEehhntimpgfthlqtaqpvtfgHHCMAYVEMFGRDISRFFDsierldecplgaaalagtsfpidrhftakelgfreptrnsidsvsdrDFILECLSHSAICAMHMSRLAEEIILwstpqfnfvrlsdafstgssimpqkrnpdgaeLVRAKTGRINGALLSLLTIMKGlplayskdmqedkepvFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVshaglpfreahyitGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISsrksfggtcAAEVLKQVTYWRNRIQNIPKKI
mskkiksnevnqmwggrfssspswiMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTakelgfreptrnsidsvsDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFStgssimpqkrnpdGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSIssrksfggtcAAEVLKQVtywrnriqnipkki
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEitndlkklltilldKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI
*****************FSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNI****
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQ*********ATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI
***************GRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI
MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target473 argininosuccinate lyase [Candidatus Liberibacter asiati
254780974435 adenylosuccinate lyase [Candidatus Liberibacter as 2e-09
254780190463 fumarate hydratase [Candidatus Liberibacter asiati 2e-08
>gi|254780974|ref|YP_003065387.1| adenylosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 435 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 147/358 (41%), Gaps = 32/358 (8%)

Query: 54  LAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLE---DIHMNIEARLTSL---IGS 107
           LAK G+I  + ++ I E  +       +  F   R +E    I  ++ A LT L   IG 
Sbjct: 34  LAKLGVIPEKSSKNIWEKGR-------NAVFNVDRIMELDSIIKHDVIAFLTHLAEIIGP 86

Query: 108 IAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQ 167
            A  +H   + +D +     + +   T  +  D+ +LL  L  +A E+ +T+  G +H  
Sbjct: 87  DARFIHQGMTSSDILDTCFSIQLMRSTDILLEDIDQLLESLKKRAFEYKDTLTIGRSHGI 146

Query: 168 TAQPVTFG-HHCMAYVEMFGRDISRFFDSIERLDECPL-GAAALAGTSFPIDRHFTAKEL 225
            A+P TFG    MAY E F R   R   + E +  C + G+        P      A  +
Sbjct: 147 HAEPTTFGLKLAMAYAE-FSRSRKRLLTAREEIAVCAISGSVGTFSNIHPYVEQHVADAM 205

Query: 226 GFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEII-LWSTPQFNFVRLSDAFST 284
           G +    +S   V  RD      S   + A  + R+A EI  L  T              
Sbjct: 206 GLKTDPISS--QVIARDRHAMYFSVLGVIASSIERVATEIRHLQRTEILEVEEFFHPGQK 263

Query: 285 GSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDK-EPVF--DAL 341
           GSS MP KRNP   E +   +  I      ++  M+ + L + +D+     E V   DA 
Sbjct: 264 GSSSMPHKRNPILTENLTGLSRLIRS---HVIPAMENVALWHERDISHSSVERVIGPDAT 320

Query: 342 ETLQIIILAISAMIEDLTVN----KDRLQEAATKSHSTATDLADWLVSHAGLPFREAH 395
             L   +  +  +IE+L V     KD L++     HS    LA   ++ AG+   EA+
Sbjct: 321 IHLDFALNRLKNVIEELVVYPENMKDNLEQLKGLIHSQRILLA---LTQAGVSREEAY 375

>gi|254780190|ref|YP_003064603.1| fumarate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 463 Back     alignment
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 128/335 (38%), Gaps = 49/335 (14%)

Query: 97  IEARLTSLIGSIAGK---------MHTARSRNDQVALDLRLWIKEKTLE-ITNDLKKLLT 146
           I  R   ++G + G          ++  +S ND     + +   E+ +  +   L+ L  
Sbjct: 110 ISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHV 169

Query: 147 ILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGA 206
            L  K  +  + I  G TH Q A P+T G     Y       I R   +++ L E   G 
Sbjct: 170 ALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGG 229

Query: 207 AALA-GTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFI--------LECLSHSAIC--- 254
            A+  G + P+         GF E    +I  ++   FI        L C    A C   
Sbjct: 230 TAVGTGLNTPV---------GFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGA 280

Query: 255 ----AMHMSRLAEEI-ILWSTPQFNFVRLS-DAFSTGSSIMPQKRNPDGAELVRAKTGRI 308
               A  + ++A +I  L S P+     L       GSSIMP K NP   E +      I
Sbjct: 281 INTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHI 340

Query: 309 --NGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAM----IEDLTVNK 362
             N A ++         L   K M       ++ L+++Q++  +I +     IE +   K
Sbjct: 341 FGNHAAITFANSQGHFELNVYKPMI-----AYNVLQSIQLLSDSIDSFTINCIEGIQARK 395

Query: 363 DRLQEAATKSHSTATDLADWL-VSHAGLPFREAHY 396
           + +Q +  +S    T L   +   +A +  ++AH+
Sbjct: 396 ENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHH 430

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target473 argininosuccinate lyase [Candidatus Liberibacter asiati
315121838473 argininosuccinate lyase [Candidatus Liberibacter solana 1 0.0
332716387466 Argininosuccinate lyase [Agrobacterium sp. H13-3] Lengt 1 0.0
254700619466 argininosuccinate lyase [Brucella suis bv. 5 str. 513] 1 0.0
190893632467 argininosuccinate lyase [Rhizobium etli CIAT 652] Lengt 1 0.0
306843418466 argininosuccinate lyase [Brucella sp. BO1] Length = 466 1 0.0
327193554467 argininosuccinate lyase protein [Rhizobium etli CNPAF51 1 0.0
294851219468 argininosuccinate lyase [Brucella sp. NVSL 07-0026] Len 1 0.0
23502829466 argininosuccinate lyase [Brucella suis 1330] Length = 4 1 0.0
297247215468 argininosuccinate lyase [Brucella abortus bv. 5 str. B3 1 0.0
17986370466 argininosuccinate lyase [Brucella melitensis bv. 1 str. 1 0.0
>gi|315121838|ref|YP_004062327.1| argininosuccinate lyase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 473 Back     alignment and organism information
 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/469 (86%), Positives = 441/469 (94%)

Query: 1   MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGII 60
           M KK KS EVN+MWGGRFSSSPSWIMEKINVSIDFDKKLF+QDI GS+VHT MLAKQGII
Sbjct: 1   MRKKTKSTEVNKMWGGRFSSSPSWIMEKINVSIDFDKKLFDQDIRGSEVHTNMLAKQGII 60

Query: 61  SSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRND 120
           +  + QKII+GLK+IR+EI DGSFVFSRDLEDIHMNIEARLT+LIG +AGKMHTARSRND
Sbjct: 61  TPNDCQKIIDGLKIIRSEITDGSFVFSRDLEDIHMNIEARLTALIGPVAGKMHTARSRND 120

Query: 121 QVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMA 180
           QVALDLRLWIKEKT+EITNDL   LTILL+KA+EHH+TIMPGFTHLQTAQPVTFGHHCMA
Sbjct: 121 QVALDLRLWIKEKTIEITNDLVAFLTILLNKAKEHHDTIMPGFTHLQTAQPVTFGHHCMA 180

Query: 181 YVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSD 240
           YVEMFGRDI+RF DSI+RLDECPLG AALAGTSFPIDRHFTA+ELGFREPTRNSIDSVSD
Sbjct: 181 YVEMFGRDITRFCDSIQRLDECPLGVAALAGTSFPIDRHFTAQELGFREPTRNSIDSVSD 240

Query: 241 RDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAEL 300
           RDFI+ECLSH+AICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAEL
Sbjct: 241 RDFIIECLSHAAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAEL 300

Query: 301 VRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTV 360
           VRAKTGRING+LLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQ++ILA+SAMI+DLTV
Sbjct: 301 VRAKTGRINGSLLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQVMILAMSAMIKDLTV 360

Query: 361 NKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAML 420
           +KDRLQEAA+ S+STATDLADWLV  AGLPFREAHYITG  VSLAEKN CELA+LPL ML
Sbjct: 361 HKDRLQEAASSSNSTATDLADWLVRCAGLPFREAHYITGRAVSLAEKNNCELAELPLEML 420

Query: 421 QQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNI 469
            +ISP+ITS+VYDILKV+SSI SRKSFGGT   EVLKQV YWRNRI+N+
Sbjct: 421 TKISPIITSSVYDILKVKSSILSRKSFGGTSPEEVLKQVVYWRNRIKNL 469


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716387|ref|YP_004443853.1| Argininosuccinate lyase [Agrobacterium sp. H13-3] Length = 466 Back     alignment and organism information
>gi|254700619|ref|ZP_05162447.1| argininosuccinate lyase [Brucella suis bv. 5 str. 513] Length = 466 Back     alignment and organism information
>gi|190893632|ref|YP_001980174.1| argininosuccinate lyase [Rhizobium etli CIAT 652] Length = 467 Back     alignment and organism information
>gi|306843418|ref|ZP_07476019.1| argininosuccinate lyase [Brucella sp. BO1] Length = 466 Back     alignment and organism information
>gi|327193554|gb|EGE60444.1| argininosuccinate lyase protein [Rhizobium etli CNPAF512] Length = 467 Back     alignment and organism information
>gi|294851219|ref|ZP_06791892.1| argininosuccinate lyase [Brucella sp. NVSL 07-0026] Length = 468 Back     alignment and organism information
>gi|23502829|ref|NP_698956.1| argininosuccinate lyase [Brucella suis 1330] Length = 466 Back     alignment and organism information
>gi|297247215|ref|ZP_06930933.1| argininosuccinate lyase [Brucella abortus bv. 5 str. B3196] Length = 468 Back     alignment and organism information
>gi|17986370|ref|NP_539004.1| argininosuccinate lyase [Brucella melitensis bv. 1 str. 16M] Length = 466 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 argininosuccinate lyase [Candidatus Liberibacter asiati
COG0165459 COG0165, ArgH, Argininosuccinate lyase [Amino acid tran 0.0
PRK00855459 PRK00855, PRK00855, argininosuccinate lyase; Provisiona 0.0
TIGR00838455 TIGR00838, argH, argininosuccinate lyase 1e-171
PLN02646474 PLN02646, PLN02646, argininosuccinate lyase 1e-162
PRK04833455 PRK04833, PRK04833, argininosuccinate lyase; Provisiona 1e-149
KOG1316464 KOG1316, KOG1316, KOG1316, Argininosuccinate lyase [Ami 1e-143
PRK12308 614 PRK12308, PRK12308, bifunctional argininosuccinate lyas 1e-140
cd01359435 cd01359, Argininosuccinate_lyase, Argininosuccinate lya 0.0
cd01334325 cd01334, Lyase_I, Lyase class I family; a group of prot 1e-109
TIGR00928435 TIGR00928, purB, adenylosuccinate lyase 8e-16
COG0114462 COG0114, FumC, Fumarase [Energy production and conversi 1e-12
PRK14515479 PRK14515, PRK14515, aspartate ammonia-lyase; Provisiona 1e-12
PRK07492435 PRK07492, PRK07492, adenylosuccinate lyase; Provisional 1e-07
pfam00206312 pfam00206, Lyase_1, Lyase 1e-69
PRK02186887 PRK02186, PRK02186, argininosuccinate lyase; Provisiona 2e-57
PRK06389434 PRK06389, PRK06389, argininosuccinate lyase; Provisiona 7e-28
COG0015438 COG0015, PurB, Adenylosuccinate lyase [Nucleotide trans 2e-24
PRK06390451 PRK06390, PRK06390, adenylosuccinate lyase; Provisional 5e-08
PRK06705502 PRK06705, PRK06705, argininosuccinate lyase; Provisiona 9e-51
cd01594231 cd01594, Lyase_I_like, Lyase class I_like superfamily: 1e-50
TIGR02426338 TIGR02426, protocat_pcaB, 3-carboxy-cis,cis-muconate cy 2e-12
cd01595381 cd01595, Adenylsuccinate_lyase_like, Adenylsuccinate ly 3e-23
cd01360387 cd01360, Adenylsuccinate_lyase_1, Adenylsuccinate lyase 3e-15
PRK08540449 PRK08540, PRK08540, adenylosuccinate lyase; Reviewed 1e-11
PRK08470442 PRK08470, PRK08470, adenylosuccinate lyase; Provisional 3e-07
PRK13353473 PRK13353, PRK13353, aspartate ammonia-lyase; Provisiona 2e-20
cd01597437 cd01597, pCLME, prokaryotic 3-carboxy-cis,cis-muconate 4e-20
COG1027471 COG1027, AspA, Aspartate ammonia-lyase [Amino acid tran 3e-17
cd01357450 cd01357, Aspartase, Aspartase 5e-17
TIGR00839468 TIGR00839, aspA, aspartate ammonia-lyase 1e-14
KOG2700481 KOG2700, KOG2700, KOG2700, Adenylosuccinate lyase [Nucl 3e-09
cd01596450 cd01596, Aspartase_like, aspartase (L-aspartate ammonia 1e-15
PRK12273472 PRK12273, aspA, aspartate ammonia-lyase; Provisional 1e-11
cd01362455 cd01362, Fumarase_classII, Class II fumarases 4e-09
PLN00134458 PLN00134, PLN00134, fumarate hydratase; Provisional 6e-09
KOG1317487 KOG1317, KOG1317, KOG1317, Fumarase [Energy production 7e-09
TIGR00979458 TIGR00979, fumC_II, fumarate hydratase, class II 1e-08
PRK09053452 PRK09053, PRK09053, 3-carboxy-cis,cis-muconate cycloiso 2e-07
PRK07380431 PRK07380, PRK07380, adenylosuccinate lyase; Provisional 8e-05
cd03302436 cd03302, Adenylsuccinate_lyase_2, Adenylsuccinate lyase 2e-04
PRK00485464 PRK00485, fumC, fumarate hydratase; Reviewed 4e-09
>gnl|CDD|30514 COG0165, ArgH, Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179143 PRK00855, PRK00855, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|129918 TIGR00838, argH, argininosuccinate lyase Back     alignment and domain information
>gnl|CDD|178252 PLN02646, PLN02646, argininosuccinate lyase Back     alignment and domain information
>gnl|CDD|179883 PRK04833, PRK04833, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|36530 KOG1316, KOG1316, KOG1316, Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>gnl|CDD|176463 cd01359, Argininosuccinate_lyase, Argininosuccinate lyase (argininosuccinase, ASAL) Back     alignment and domain information
>gnl|CDD|176461 cd01334, Lyase_I, Lyase class I family; a group of proteins which catalyze similar beta-elimination reactions Back     alignment and domain information
>gnl|CDD|162114 TIGR00928, purB, adenylosuccinate lyase Back     alignment and domain information
>gnl|CDD|30463 COG0114, FumC, Fumarase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184723 PRK14515, PRK14515, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|181000 PRK07492, PRK07492, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|143963 pfam00206, Lyase_1, Lyase Back     alignment and domain information
>gnl|CDD|167327 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|102352 PRK06389, PRK06389, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|30365 COG0015, PurB, Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180551 PRK06390, PRK06390, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|180664 PRK06705, PRK06705, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|176466 cd01594, Lyase_I_like, Lyase class I_like superfamily: contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase, which catalyze similar beta-elimination reactions Back     alignment and domain information
>gnl|CDD|162853 TIGR02426, protocat_pcaB, 3-carboxy-cis,cis-muconate cycloisomerase Back     alignment and domain information
>gnl|CDD|176467 cd01595, Adenylsuccinate_lyase_like, Adenylsuccinate lyase (ASL)_like Back     alignment and domain information
>gnl|CDD|176464 cd01360, Adenylsuccinate_lyase_1, Adenylsuccinate lyase (ASL)_subgroup 1 Back     alignment and domain information
>gnl|CDD|181463 PRK08540, PRK08540, adenylosuccinate lyase; Reviewed Back     alignment and domain information
>gnl|CDD|181437 PRK08470, PRK08470, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|183992 PRK13353, PRK13353, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|176469 cd01597, pCLME, prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like Back     alignment and domain information
>gnl|CDD|31230 COG1027, AspA, Aspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176462 cd01357, Aspartase, Aspartase Back     alignment and domain information
>gnl|CDD|162062 TIGR00839, aspA, aspartate ammonia-lyase Back     alignment and domain information
>gnl|CDD|37911 KOG2700, KOG2700, KOG2700, Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|176468 cd01596, Aspartase_like, aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes Back     alignment and domain information
>gnl|CDD|183393 PRK12273, aspA, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|176465 cd01362, Fumarase_classII, Class II fumarases Back     alignment and domain information
>gnl|CDD|177743 PLN00134, PLN00134, fumarate hydratase; Provisional Back     alignment and domain information
>gnl|CDD|36531 KOG1317, KOG1317, KOG1317, Fumarase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130052 TIGR00979, fumC_II, fumarate hydratase, class II Back     alignment and domain information
>gnl|CDD|181627 PRK09053, PRK09053, 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>gnl|CDD|180954 PRK07380, PRK07380, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|176471 cd03302, Adenylsuccinate_lyase_2, Adenylsuccinate lyase (ASL)_subgroup 2 Back     alignment and domain information
>gnl|CDD|179045 PRK00485, fumC, fumarate hydratase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 473 argininosuccinate lyase [Candidatus Liberibacter asiati
TIGR00838469 argH argininosuccinate lyase; InterPro: IPR009049 This 100.0
PRK12308 614 bifunctional argininosuccinate lyase/N-acetylglutamate 100.0
COG0165459 ArgH Argininosuccinate lyase [Amino acid transport and 100.0
PRK04833455 argininosuccinate lyase; Provisional 100.0
PRK00855459 argininosuccinate lyase; Provisional 100.0
PRK06705502 argininosuccinate lyase; Provisional 100.0
KOG1316464 consensus 100.0
cd01359435 Argininosuccinate_lyase Argininosuccinate lyase (argini 100.0
PRK02186892 argininosuccinate lyase; Provisional 100.0
PRK08540449 adenylosuccinate lyase; Reviewed 100.0
cd01597437 pCLME pCLME: prokaryotic 3-carboxy-cis,cis-muconate cyc 100.0
PRK08470442 adenylosuccinate lyase; Provisional 100.0
PRK07380431 adenylosuccinate lyase; Provisional 100.0
PRK09053452 3-carboxy-cis,cis-muconate cycloisomerase; Provisional 100.0
PRK08937425 adenylosuccinate lyase; Provisional 100.0
PRK06390451 adenylosuccinate lyase; Provisional 100.0
TIGR00928469 purB adenylosuccinate lyase; InterPro: IPR004769 A numb 100.0
COG0015438 PurB Adenylosuccinate lyase [Nucleotide transport and m 100.0
PRK12273471 aspA aspartate ammonia-lyase; Provisional 100.0
PRK12425464 fumarate hydratase; Provisional 100.0
PRK09285456 adenylosuccinate lyase; Provisional 100.0
KOG2700481 consensus 100.0
PRK06389434 argininosuccinate lyase; Provisional 100.0
PRK07492433 adenylosuccinate lyase; Provisional 100.0
cd01362455 Fumarase_classII Class II fumarases. This group contain 100.0
cd01357450 Aspartatase Aspartase_like. This group contains protein 100.0
PRK00485462 fumC fumarate hydratase; Reviewed 100.0
cd03302436 Adenylsuccinate_lyase_2 Adenylsuccinate lyase_2: Adenyl 100.0
PRK13353473 aspartate ammonia-lyase; Provisional 100.0
cd01596450 Aspartatase_like Aspartase_like. This group contains pr 100.0
COG1027471 AspA Aspartate ammonia-lyase [Amino acid transport and 100.0
cd01598425 PurB PurB: PurB_like adenylosuccinases (adenylsuccinate 100.0
COG0114462 FumC Fumarase [Energy production and conversion] 100.0
TIGR00839469 aspA aspartate ammonia-lyase; InterPro: IPR004708 A num 100.0
TIGR00979459 fumC_II fumarate hydratase, class II; InterPro: IPR0056 100.0
KOG1317487 consensus 100.0
cd01360387 Adenylsuccinate_lyase_1 Adenylsuccinate lyase_1: Adenyl 100.0
cd01595381 Adenylsuccinate_lyase_like Adenylsuccinate lyase_like ( 100.0
pfam00206312 Lyase_1 Lyase. 100.0
cd01334330 Lyase_I Lyase class I family of the Lyase_I superfamily 100.0
cd01594231 Lyase_I_like Lyase class I_like. Lyase class I_like sup 100.0
PRK05975353 3-carboxy-cis,cis-muconate cycloisomerase; Provisional 100.0
TIGR02426351 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase 100.0
pfam1039781 ADSL_C Adenylosuccinate lyase C-terminus. This is the C 98.34
pfam08328115 ASL_C Adenylosuccinate lyase C-terminal. This domain is 95.9
KOG2700481 consensus 94.66
>TIGR00838 argH argininosuccinate lyase; InterPro: IPR009049 This entry represents argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>COG0165 ArgH Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04833 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK00855 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK06705 argininosuccinate lyase; Provisional Back     alignment and domain information
>KOG1316 consensus Back     alignment and domain information
>cd01359 Argininosuccinate_lyase Argininosuccinate lyase (argininosuccinase, ASAL) Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08540 adenylosuccinate lyase; Reviewed Back     alignment and domain information
>cd01597 pCLME pCLME: prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like This group contains proteins similar to pCLME, a member of the Lyase class I family Back     alignment and domain information
>PRK08470 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK07380 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK09053 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>PRK08937 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK06390 adenylosuccinate lyase; Provisional Back     alignment and domain information
>TIGR00928 purB adenylosuccinate lyase; InterPro: IPR004769 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown , to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes Back     alignment and domain information
>COG0015 PurB Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12273 aspA aspartate ammonia-lyase; Provisional Back     alignment and domain information
>PRK12425 fumarate hydratase; Provisional Back     alignment and domain information
>PRK09285 adenylosuccinate lyase; Provisional Back     alignment and domain information
>KOG2700 consensus Back     alignment and domain information
>PRK06389 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK07492 adenylosuccinate lyase; Provisional Back     alignment and domain information
>cd01362 Fumarase_classII Class II fumarases Back     alignment and domain information
>cd01357 Aspartatase Aspartase_like Back     alignment and domain information
>PRK00485 fumC fumarate hydratase; Reviewed Back     alignment and domain information
>cd03302 Adenylsuccinate_lyase_2 Adenylsuccinate lyase_2: Adenylsuccinate lyase (ASL)_subgroup 2 Back     alignment and domain information
>PRK13353 aspartate ammonia-lyase; Provisional Back     alignment and domain information
>cd01596 Aspartatase_like Aspartase_like Back     alignment and domain information
>COG1027 AspA Aspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01598 PurB PurB: PurB_like adenylosuccinases (adenylsuccinate lyase, ASL) Back     alignment and domain information
>COG0114 FumC Fumarase [Energy production and conversion] Back     alignment and domain information
>TIGR00839 aspA aspartate ammonia-lyase; InterPro: IPR004708 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown , to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes Back     alignment and domain information
>TIGR00979 fumC_II fumarate hydratase, class II; InterPro: IPR005677 Fumarase C catalyzes the stereospecific interconversion of fumarate to L-malate as part of the metabolic citric acid or Kreb's cycle Back     alignment and domain information
>KOG1317 consensus Back     alignment and domain information
>cd01360 Adenylsuccinate_lyase_1 Adenylsuccinate lyase_1: Adenylsuccinate lyase (ASL)_subgroup 1 Back     alignment and domain information
>cd01595 Adenylsuccinate_lyase_like Adenylsuccinate lyase_like (ASL_like): This subgroup contains proteins similar to ASL and prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE) Back     alignment and domain information
>pfam00206 Lyase_1 Lyase Back     alignment and domain information
>cd01334 Lyase_I Lyase class I family of the Lyase_I superfamily Back     alignment and domain information
>cd01594 Lyase_I_like Lyase class I_like Back     alignment and domain information
>PRK05975 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>TIGR02426 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase; InterPro: IPR012789 Proteins in this entry are 3-carboxy-cis,cis-muconate cycloisomerases, which catalyse the second step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA Back     alignment and domain information
>pfam10397 ADSL_C Adenylosuccinate lyase C-terminus Back     alignment and domain information
>pfam08328 ASL_C Adenylosuccinate lyase C-terminal Back     alignment and domain information
>KOG2700 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target473 argininosuccinate lyase [Candidatus Liberibacter asiati
2e9f_A462 Crystal Structure Of T.Th.Hb8 Argininosuccinate Lya 1e-113
1k7w_A468 Crystal Structure Of S283a Duck Delta 2 Crystallin 1e-110
1auw_A468 H91n Delta 2 Crystallin From Duck Length = 468 1e-110
1aos_A464 Human Argininosuccinate Lyase Length = 464 1e-109
1hy1_A468 Crystal Structure Of Wild Type Duck Delta 2 Crystal 1e-109
1tj7_A457 Structure Determination And Refinement At 2.44 A Re 1e-109
2e9f_B454 Crystal Structure Of T.Th.Hb8 Argininosuccinate Lya 1e-109
1k62_A464 Crystal Structure Of The Human Argininosuccinate Ly 1e-109
1tju_A474 Crystal Structure Of T161s Duck Delta 2 Crystallin 1e-108
1tjv_A474 Crystal Structure Of T161d Duck Delta 2 Crystallin 1e-108
1u15_A472 Crystal Structure Of A Duck-Delta-Crystallin-1 Doub 1e-107
1xwo_A465 Crystal Structrue Of Goose Delta Crystallin Length 1e-103
1hy0_A466 Crystal Structure Of Wild Type Duck Delta 1 Crystal 1e-101
1dcn_A447 Inactive Mutant H162n Of Delta 2 Crystallin With Bo 1e-100
1i0a_A466 Crystal Structure Of Wild Type Turkey Delta 1 Cryst 2e-96
2x75_A431 Staphylococcus Aureus Adenylosuccinate Lyase Length 6e-34
1f1o_A431 Structural Studies Of Adenylosuccinate Lyases Lengt 9e-33
2pfm_A444 Crystal Structure Of Adenylosuccinate Lyase (Purb) 1e-32
1q5n_A454 Crystal Structure Of Beta-Carboxy-Cis,Cis-Muconate 2e-32
1j3u_A468 Crystal Structure Of Aspartase From Bacillus Sp. Ym 1e-31
1kq7_A467 E315q Mutant Form Of Fumarase C From E.Coli Length 5e-29
1fuo_A467 Fumarase C With Bound Citrate Length = 467 7e-29
2fus_A467 Mutations Of Fumarase That Distinguish Between The 1e-28
1fup_A472 Fumarase With Bound Pyromellitic Acid Length = 472 2e-28
1fur_A467 Fumarase Mutant H188n With Bound Substrate L-Malate 3e-28
1c3u_A431 T. Maritima Adenylosuccinate Lyase Length = 431 2e-27
1vdk_A466 Crystal Structure Of Fumarase From Thermus Thermoph 8e-27
1c3c_A429 T. Maritima Adenylosuccinate Lyase Length = 429 9e-27
3ocf_A478 Crystal Structure Of Fumarate Lyase:delta Crystalli 5e-23
3oce_A474 Crystal Structure Of Fumarate Lyase:delta Crystalli 6e-23
3no9_A475 Crystal Structure Of Apo Fumarate Hydratase From My 4e-18
3qbp_A478 Crystal Structure Of Fumarase Fum From Mycobacteriu 5e-17
3rrp_A471 Crystal Structure Of Fumarate Hydratase Fum From My 1e-11
3c8t_A451 Crystal Structure Of Fumarate Lyase From Mesorhizob 9e-31
1re5_A450 Crystal Structure Of 3-Carboxy-Cis,Cis-Muconate Lac 2e-25
1jsw_A478 Native L-Aspartate Ammonia Lyase Length = 478 1e-23
1yfm_A488 Recombinant Yeast Fumarase Length = 488 8e-23
3e04_A490 Crystal Structure Of Human Fumarate Hydratase Lengt 7e-22
3gtd_A482 2.4 Angstrom Crystal Structure Of Fumarate Hydratas 2e-21
2vd6_A503 Human Adenylosuccinate Lyase In Complex With Its Su 2e-11
2j91_A503 Crystal Structure Of Human Adenylosuccinate Lyase I 3e-11
3bhg_A459 Crystal Structure Of Adenylosuccinate Lyase From Le 7e-05
3gzh_A482 Crystal Structure Of Phosphate-Bound Adenylosuccina 0.001
2fel_A359 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From 5e-14
1dof_A403 The Crystal Structure Of Adenylosuccinate Lyase Fro 6e-11
1yis_A478 Structural Genomics Of Caenorhabditis Elegans: Aden 1e-08
2qga_B465 Plasmodium Vivax Adenylosuccinate Lyase Pv003765 Wi 8e-06
2hvg_A482 Crystal Structure Of Adenylosuccinate Lyase From Pl 3e-05
gi|157834857|pdb|2E9F|A Chain A, Crystal Structure Of T.Th.Hb8 Argininosuccinate Lyase Complexed With L-Arginine Length = 462 Back     alignment and structure
 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 218/458 (47%), Positives = 306/458 (66%), Gaps = 3/458 (0%)

Query: 10  VNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGIISSEEAQKII 69
            ++ WGGRF   P  +  + N S+ FD+ L+ +D+  ++VH  ML   G++S+EE + I+
Sbjct: 2   AHRTWGGRFGEGPDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAIL 61

Query: 70  EGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRNDQVALDLRLW 129
           +GL  I  EI  G+F +  +LED+HMN+EARLT L+G   GK+HTARSRNDQVA DLRL+
Sbjct: 62  KGLDRIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLY 121

Query: 130 IKEKTLEITNDLKKLLTILLDKAEEHHNTIM--PGFTHLQTAQPVTFGHHCMAYVEMFGR 187
           ++    E+   L  L  +L+ +AE+H + +   PG+THLQ AQPV   H  +AY EM  R
Sbjct: 122 LRGAIDELLALLLALRRVLVREAEKHLDPLYVLPGYTHLQRAQPVLLAHWFLAYYEMLKR 181

Query: 188 DISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFILEC 247
           D  R  D+ ERL+E PLGAAALAGT FPIDRHFTA+ELGF+ P RNS+D+V+ RDF LE 
Sbjct: 182 DAGRLEDAKERLNESPLGAAALAGTGFPIDRHFTARELGFKAPMRNSLDAVASRDFALEV 241

Query: 248 LSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAELVRAKTGR 307
           LS   I  +H+SR+AEE+IL+ST +F FV + DAF+TGSSIMPQK+NPD  EL+RAK GR
Sbjct: 242 LSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFATGSSIMPQKKNPDILELIRAKAGR 301

Query: 308 INGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTVNKDRLQE 367
           + GA + L  ++KGLPLAY+KD+QEDKEP+ DAL T +  +  ++A++  L   ++R+  
Sbjct: 302 VLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAALLPGLKWRRERMWR 361

Query: 368 AATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAMLQQISPVI 427
           AA   ++ AT+LAD+L    GLPFREAH++ G  V    +    L  L L  LQ   P+ 
Sbjct: 362 AAEGGYTLATELADYLA-EKGLPFREAHHVVGRLVRRLVEEGRALKDLTLEELQAHHPLF 420

Query: 428 TSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNR 465
                 +L++E++I  R+S+GGT    V +++   +  
Sbjct: 421 AEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKKE 458


>gi|20150709|pdb|1K7W|A Chain A, Crystal Structure Of S283a Duck Delta 2 Crystallin Mutant Length = 468 Back     alignment and structure
>gi|2981709|pdb|1AUW|A Chain A, H91n Delta 2 Crystallin From Duck Length = 468 Back     alignment and structure
>gi|2914651|pdb|1AOS|A Chain A, Human Argininosuccinate Lyase Length = 464 Back     alignment and structure
gi|14278423|pdb|1HY1|A Chain A, Crystal Structure Of Wild Type Duck Delta 2 Crystallin (Eye Lens Protein) Length = 468 Back     alignment and structure
gi|56553869|pdb|1TJ7|A Chain A, Structure Determination And Refinement At 2.44 A Resolution Of Argininosuccinate Lyase From E. Coli Length = 457 Back     alignment and structure
>gi|18655512|pdb|1K62|A Chain A, Crystal Structure Of The Human Argininosuccinate Lyase Q286r Mutant Length = 464 Back     alignment and structure
>gi|55669953|pdb|1TJU|A Chain A, Crystal Structure Of T161s Duck Delta 2 Crystallin Mutant Length = 474 Back     alignment and structure
>gi|55669957|pdb|1TJV|A Chain A, Crystal Structure Of T161d Duck Delta 2 Crystallin Mutant Length = 474 Back     alignment and structure
>gi|55670107|pdb|1U15|A Chain A, Crystal Structure Of A Duck-Delta-Crystallin-1 Double Loop Mutant (Dlm) Length = 472 Back     alignment and structure
>gi|82407488|pdb|1XWO|A Chain A, Crystal Structrue Of Goose Delta Crystallin Length = 465 Back     alignment and structure
>gi|14278421|pdb|1HY0|A Chain A, Crystal Structure Of Wild Type Duck Delta 1 Crystallin (Eye Lens Protein) Length = 466 Back     alignment and structure
>gi|157872869|pdb|1DCN|A Chain A, Inactive Mutant H162n Of Delta 2 Crystallin With Bound Argininosuccinate Length = 447 Back     alignment and structure
gi|14278427|pdb|1I0A|A Chain A, Crystal Structure Of Wild Type Turkey Delta 1 Crystallin (Eye Lens Protein) Length = 466 Back     alignment and structure
gi|290789885|pdb|2X75|A Chain A, Staphylococcus Aureus Adenylosuccinate Lyase Length = 431 Back     alignment and structure
gi|13096694|pdb|1F1O|A Chain A, Structural Studies Of Adenylosuccinate Lyases Length = 431 Back     alignment and structure
>gi|146387382|pdb|2PFM|A Chain A, Crystal Structure Of Adenylosuccinate Lyase (Purb) From Bacillus Anthracis Length = 444 Back     alignment and structure
>gi|34810579|pdb|1Q5N|A Chain A, Crystal Structure Of Beta-Carboxy-Cis,Cis-Muconate Cycloisomerase (Cmle) From Acinetobacter Calcoaceticus Sp. Adp1 Length = 454 Back     alignment and structure
>gi|30749354|pdb|1J3U|A Chain A, Crystal Structure Of Aspartase From Bacillus Sp. Ym55-1 Length = 468 Back     alignment and structure
>gi|23200276|pdb|1KQ7|A Chain A, E315q Mutant Form Of Fumarase C From E.Coli Length = 467 Back     alignment and structure
gi|1942160|pdb|1FUO|A Chain A, Fumarase C With Bound Citrate Length = 467 Back     alignment and structure
>gi|2392682|pdb|2FUS|A Chain A, Mutations Of Fumarase That Distinguish Between The Active Site And A Nearby Dicarboxylic Acid Binding Site Length = 467 Back     alignment and structure
>gi|1942162|pdb|1FUP|A Chain A, Fumarase With Bound Pyromellitic Acid Length = 472 Back     alignment and structure
>gi|2392342|pdb|1FUR|A Chain A, Fumarase Mutant H188n With Bound Substrate L-Malate At Putative Activator Site Length = 467 Back     alignment and structure
gi|7245290|pdb|1C3U|A Chain A, T. Maritima Adenylosuccinate Lyase Length = 431 Back     alignment and structure
>gi|48425891|pdb|1VDK|A Chain A, Crystal Structure Of Fumarase From Thermus Thermophilus Hb8 Length = 466 Back     alignment and structure
>gi|7245816|pdb|1C3C|A Chain A, T. Maritima Adenylosuccinate Lyase Length = 429 Back     alignment and structure
>gi|303325218|pdb|3OCF|A Chain A, Crystal Structure Of Fumarate Lyase:delta Crystallin From Brucella Melitensis In Native Form Length = 478 Back     alignment and structure
>gi|303325214|pdb|3OCE|A Chain A, Crystal Structure Of Fumarate Lyase:delta Crystallin From Brucella Melitensis Bound To Cobalt Length = 474 Back     alignment and structure
>gi|300508783|pdb|3NO9|A Chain A, Crystal Structure Of Apo Fumarate Hydratase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>gi|320089966|pdb|3QBP|A Chain A, Crystal Structure Of Fumarase Fum From Mycobacterium Marinum Length = 478 Back     alignment and structure
>gi|332639961|pdb|3RRP|A Chain A, Crystal Structure Of Fumarate Hydratase Fum From Mycobacterium Abscessus With Malate Bound Length = 471 Back     alignment and structure
>gi|169791879|pdb|3C8T|A Chain A, Crystal Structure Of Fumarate Lyase From Mesorhizobium Sp. Bnc1 Length = 451 Back     alignment and structure
>gi|49258707|pdb|1RE5|A Chain A, Crystal Structure Of 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 450 Back     alignment and structure
gi|2392396|pdb|1JSW|A Chain A, Native L-Aspartate Ammonia Lyase Length = 478 Back     alignment and structure
>gi|157834306|pdb|1YFM|A Chain A, Recombinant Yeast Fumarase Length = 488 Back     alignment and structure
>gi|196049942|pdb|3E04|A Chain A, Crystal Structure Of Human Fumarate Hydratase Length = 490 Back     alignment and structure
>gi|254221004|pdb|3GTD|A Chain A, 2.4 Angstrom Crystal Structure Of Fumarate Hydratase From Rickettsia Prowazekii Length = 482 Back     alignment and structure
>gi|159795583|pdb|2VD6|A Chain A, Human Adenylosuccinate Lyase In Complex With Its Substrate N6-(1,2-Dicarboxyethyl)-Amp, And Its Products Amp And Fumarate. Length = 503 Back     alignment and structure
>gi|119390451|pdb|2J91|A Chain A, Crystal Structure Of Human Adenylosuccinate Lyase In Complex With Amp Length = 503 Back     alignment and structure
>gi|161761247|pdb|3BHG|A Chain A, Crystal Structure Of Adenylosuccinate Lyase From Legionella Pneumophila Length = 459 Back     alignment and structure
>gi|256599714|pdb|3GZH|A Chain A, Crystal Structure Of Phosphate-Bound Adenylosuccinate Lyase From E. Coli Length = 482 Back     alignment and structure
>gi|118137741|pdb|2FEL|A Chain A, 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From Agrobacterium Radiobacter S2 Length = 359 Back     alignment and structure
>gi|13096685|pdb|1DOF|A Chain A, The Crystal Structure Of Adenylosuccinate Lyase From Pyrobaculum Aerophilum: Insights Into Thermal Stability And Human Pathology Length = 403 Back     alignment and structure
>gi|60594392|pdb|1YIS|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Adenylosuccinate Lyase Length = 478 Back     alignment and structure
>gi|157835920|pdb|2QGA|B Chain B, Plasmodium Vivax Adenylosuccinate Lyase Pv003765 With Amp Bound Length = 465 Back     alignment and structure
>gi|114794583|pdb|2HVG|A Chain A, Crystal Structure Of Adenylosuccinate Lyase From Plasmodium Vivax Length = 482 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 argininosuccinate lyase [Candidatus Liberibacter asiati
1k7w_A468 Delta 2 crystallin; eye lens protein, argininosuccinate 1e-126
2e9f_A462 Argininosuccinate lyase; alpha helix bundle; HET: ARG; 1e-106
1tj7_A457 Argininosuccinate lyase; crystallin, E. coli, fumarase, 1e-103
1q5n_A454 3-carboxy-CIS,CIS-muconate cycloisomerase; CMLE, aromat 1e-71
1re5_A450 3-carboxy-CIS,CIS-muconate cycloisomerase; homotetramer 3e-40
3no9_A475 Fumarase C, fumarate hydratase class II; APO, structura 6e-76
3ocf_A478 Fumarate lyase:delta crystallin; fumarase, brucellosis, 3e-73
1j3u_A468 Aspartase; multi-domains, lyase; 2.50A {Bacillus SP} SC 4e-72
1jsw_A478 L-aspartase, L-aspartate ammonia-lyase; amino acid ammo 3e-70
3gtd_A482 Fumarase C, fumarate hydratase class II; structural gen 8e-67
1fur_A467 Fumarase C, FUMC; hydrolyase, carbon oxygen lyase, KREB 2e-60
2pfm_A444 Adenylosuccinate lyase; PURB, purine biosynthesis; 2.00 1e-57
1yfm_A488 Fumarase, YFUM; lyase, krebs cycle, active site water, 4e-50
1c3c_A429 Protein (adenylosuccinate lyase); purine biosynthesis; 1e-49
1vdk_A466 Fumarase C, fumarate hydratase class II; TCA cycle, rik 5e-45
1dof_A403 Adenylosuccinate lyase; purine biosynthesis; 2.10A {Pyr 9e-32
3bhg_A459 Adenylosuccinate lyase; structural genomics, PSI-2, pro 1e-30
2qga_B465 Adenylosuccinate lyase; malaria, PV003765, SGC, structu 5e-30
3e04_A490 Fumarase, fumarate hydratase; TCA cycle, structural gen 9e-49
3c8t_A451 Fumarate lyase; structural genomics, PSI-2, protein str 2e-42
2fel_A359 3-carboxy-CIS,CIS-muconate lactonizing enzyme; biodegra 2e-38
1yis_A478 Adenylosuccinate lyase; structural genomics, PSI, prote 8e-36
2j91_A503 Adenylosuccinate lyase; disease mutation, adenylosuccin 1e-30
2ptr_A462 Adenylosuccinate lyase; mutant-substrate complex; HET: 4e-29
>1k7w_A Delta 2 crystallin; eye lens protein, argininosuccinate lyase, enzyme mechanism; HET: AS1; 1.96A {Anas platyrhynchos} SCOP: a.127.1.1 PDB: 1hy1_A 1tju_A 1auw_A 1tjv_A 1tjw_A* 1u16_A* 1u15_A* 1dcn_A* 1xwo_A 1hy0_A 1i0a_A 1aos_A 1k62_A Length = 468 Back     alignment and structure
 Score =  447 bits (1151), Expect = e-126
 Identities = 196/472 (41%), Positives = 295/472 (62%), Gaps = 5/472 (1%)

Query: 1   MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDILGSKVHTTMLAKQGII 60
           M+ + + +   ++WGGRFS S   IMEK+N SI +D++L E DI GS  +   L K GI+
Sbjct: 1   MASEARGD---KLWGGRFSGSTDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGIL 57

Query: 61  SSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSLIGSIAGKMHTARSRND 120
           +  E +KI+ GL+ I  E   G FV  +  EDIH   E RL  LIG IAGK+HT RSRND
Sbjct: 58  TKTELEKILSGLEKISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRND 117

Query: 121 QVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMA 180
           QV  DL+L++K     I+  L +L+  L+++A    + I+PG+THLQ AQP+ +    ++
Sbjct: 118 QVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLS 177

Query: 181 YVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTAKELGFREPTRNSIDSVSD 240
           +     RD  R  +  +R++  PLG+ ALAG    IDR     EL F   + NS+D++S+
Sbjct: 178 HAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISLNSMDAISE 237

Query: 241 RDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDAFSTGSSIMPQKRNPDGAEL 300
           RDF++E LS + +  +H+S++AE++I++ST +F F+ LSDAFSTG+S+MPQK+NPD  EL
Sbjct: 238 RDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFSTGASLMPQKKNPDSLEL 297

Query: 301 VRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAMIEDLTV 360
           +R+K GR+ G L S+L ++KGLP  Y+KD+QEDKE VFD ++TL  ++   + +I  L +
Sbjct: 298 IRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQI 357

Query: 361 NKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITGCTVSLAEKNQCELAKLPLAML 420
           +K+ +++A T     ATDLA +LV   G+PFR+AH  +G  V LAE     + KL L  L
Sbjct: 358 SKENMEKALTP-EMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDL 415

Query: 421 QQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQVTYWRNRIQNIPKK 472
           + ISP  +S V  +    +S+    + GGT  + V  Q+   R  ++   ++
Sbjct: 416 KSISPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRELMKKQKEQ 467