254780371

254780371

diaminopimelate decarboxylase protein

GeneID in NCBI database:8209356Locus tag:CLIBASIA_01280
Protein GI in NCBI database:254780371Protein Accession:YP_003064784.1
Gene range:+(269636, 270931)Protein Length:431aa
Gene description:diaminopimelate decarboxylase protein
COG prediction:[E] Diaminopimelate decarboxylase
KEGG prediction:lysA; diaminopimelate decarboxylase protein; K01586 diaminopimelate decarboxylase [EC:4.1.1.20]
SEED prediction:Diaminopimelate decarboxylase (EC 4.1.1.20)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSENY
cccccccccEEEEccccHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHccccEEEccHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccccHHHHHHHHHHHccccccEEEEEccHHHHHccEEEEEEEEEEEEccccEEEEEcccccccccHHHHHcccccEEccccccccccEEEEEEEccccccccccccccccccccccEEEEEccccccHHHccccccccccEEEEEEcccEEEEEEcccHHHHHccccccHHHHHHHHHHHccc
ccccHcccccEEcccccHHHHHHHHccccEEEcHHHHHHHHHHHHHHHcccccHEHHHHHHcHHHHHHHHHHHccccccEcccHHHHHHHHccccHHEEEEccccccHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHccccccEEEEEcccccccccccEccccccccccccHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccEEcccccccccHHHHHHHHHHHHcccccEEEEccccEEEEcccEEEEEEEEEcccccccEEEEEHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccHHcccccccccccccEEEEEEcccccEEEcccccccccccEEEEccccEEEEEEcccHHHHHHcccccHHHHcccccccccc
MSAFKYFEGSLHAENVSLEKLAhvvqtpfycysTTAIEKNYltfsnafdGMDTMVCYALKANSNQAVIKTLAHLgsgldivsegelrralaapvpaerivfsgvgkTIDEIDLALQSGiycfnvesesELKTLNQRAVSlgkkapiafrvnpdinanthkkistgkkedkfgipihqihSLYAyastlpgvkisgvdmhigsqIDQIESFHKAFKLLRDLTQQLRsnghniqhidvggglgiayhsdhrppsssdyASLIHQYFGNlqckiilepgrfLVADVGILVTKVISIKKSADKTFVILDVAMndfmrptlydaYHEINYivnpagdrlhihadivgpicetgdfialnrkialprpgdllyiektgaygavqsgtynsrllipeimvngsqfhiirprmTFQELIeldsipawlqktpkqsseny
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALaapvpaerivfSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLgkkapiafrvnpdinanthkkistgkkedkfGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKvisikksadktfVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELdsipawlqktpkqsseny
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSENY
*SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA*************
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQ**********
*SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSENY
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSENY
MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSENY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target431 diaminopimelate decarboxylase protein [Candidatus Liber
315121839422 diaminopimelate decarboxylase protein [Candidatus Liber 1 0.0
190893634422 diaminopimelate decarboxylase [Rhizobium etli CIAT 652] 1 1e-159
241206546422 diaminopimelate decarboxylase [Rhizobium leguminosarum 1 1e-159
116254060422 diaminopimelate decarboxylase [Rhizobium leguminosarum 1 1e-159
209551143422 diaminopimelate decarboxylase [Rhizobium leguminosarum 1 1e-157
86359380422 diaminopimelate decarboxylase protein [Rhizobium etli C 1 1e-156
150397736422 diaminopimelate decarboxylase [Sinorhizobium medicae WS 1 1e-156
15891339422 diaminopimelate decarboxylase [Agrobacterium tumefacien 1 1e-156
15966402422 diaminopimelate DAP decarboxylase protein [Sinorhizobiu 1 1e-156
332716389422 Diaminopimelate decarboxylase [Agrobacterium sp. H13-3] 1 1e-156
>gi|315121839|ref|YP_004062328.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 422 Back     alignment and organism information
 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/422 (80%), Positives = 381/422 (90%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AFKY+ GSLHAE+VSLEK++  VQTPFYCY+T AIE+NYLTFS A DGM+TM+CYA+K
Sbjct: 1   MNAFKYYRGSLHAEDVSLEKISQTVQTPFYCYATAAIEQNYLTFSRALDGMNTMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAVI+TLA LGSGLDIVSEGEL RAL+A VPAE+IVFSGVGKTI E+DLALQ+GIY
Sbjct: 61  ANSNQAVIQTLARLGSGLDIVSEGELHRALSAQVPAEKIVFSGVGKTISEMDLALQTGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESESEL TLNQRA+SLGK API+FRVNPD+NANTHKKISTGKKEDKFGIPIHQIHS
Sbjct: 121 CFNIESESELITLNQRAISLGKIAPISFRVNPDVNANTHKKISTGKKEDKFGIPIHQIHS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY YA  LPG+KISG+DMHIGSQI+QIESF +AFKLLR+ T +LRS+GHNIQHIDVGGGL
Sbjct: 181 LYDYAKDLPGIKISGIDMHIGSQINQIESFCQAFKLLRETTLKLRSDGHNIQHIDVGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y HS+  PPS SDYASLIH+YFG+LQCKIILEPGRFLVAD GILV+KVIS+KKS DK
Sbjct: 241 GITYCHSNPPPPSPSDYASLIHKYFGDLQCKIILEPGRFLVADAGILVSKVISVKKSTDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILDVAMNDFMRPTLYDAYHEI YI +P   RLH+ ADIVGPICETGDFIALNR I L
Sbjct: 301 IFIILDVAMNDFMRPTLYDAYHEIKYISSPEEGRLHVQADIVGPICETGDFIALNRTIPL 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GD+LYIEK GAYGAVQSGTYNSR LIPE+MV  SQFHIIRPRM+FQ+LIE+DS P W
Sbjct: 361 PQAGDILYIEKAGAYGAVQSGTYNSRRLIPEVMVKDSQFHIIRPRMSFQKLIEMDSTPEW 420

Query: 420 LQ 421
           L+
Sbjct: 421 LK 422


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190893634|ref|YP_001980176.1| diaminopimelate decarboxylase [Rhizobium etli CIAT 652] Length = 422 Back     alignment and organism information
>gi|241206546|ref|YP_002977642.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 422 Back     alignment and organism information
>gi|116254060|ref|YP_769898.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. viciae 3841] Length = 422 Back     alignment and organism information
>gi|209551143|ref|YP_002283060.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 422 Back     alignment and organism information
>gi|86359380|ref|YP_471272.1| diaminopimelate decarboxylase protein [Rhizobium etli CFN 42] Length = 422 Back     alignment and organism information
>gi|150397736|ref|YP_001328203.1| diaminopimelate decarboxylase [Sinorhizobium medicae WSM419] Length = 422 Back     alignment and organism information
>gi|15891339|ref|NP_357011.1| diaminopimelate decarboxylase [Agrobacterium tumefaciens str. C58] Length = 422 Back     alignment and organism information
>gi|15966402|ref|NP_386755.1| diaminopimelate DAP decarboxylase protein [Sinorhizobium meliloti 1021] Length = 422 Back     alignment and organism information
>gi|332716389|ref|YP_004443855.1| Diaminopimelate decarboxylase [Agrobacterium sp. H13-3] Length = 422 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target431 diaminopimelate decarboxylase protein [Candidatus Liber
TIGR01048417 TIGR01048, lysA, diaminopimelate decarboxylase 1e-131
COG0019394 COG0019, LysA, Diaminopimelate decarboxylase [Amino aci 1e-111
cd06810368 cd06810, PLPDE_III_ODC_DapDC_like, Type III Pyridoxal 5 4e-85
PLN02537410 PLN02537, PLN02537, diaminopimelate decarboxylase 5e-73
PRK11165420 PRK11165, PRK11165, diaminopimelate decarboxylase; Prov 5e-59
PRK08961861 PRK08961, PRK08961, bifunctional aspartate kinase/diami 7e-57
cd06828373 cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphat 1e-141
cd06839382 cd06839, PLPDE_III_Btrk_like, Type III Pyridoxal 5-phos 3e-68
cd00622362 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate 4e-50
TIGR03099398 TIGR03099, dCO2ase_PEP1, pyridoxal-dependent decarboxyl 2e-48
KOG0622448 KOG0622, KOG0622, KOG0622, Ornithine decarboxylase [Ami 3e-47
cd06841379 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phos 3e-43
cd06836379 cd06836, PLPDE_III_ODC_DapDC_like_1, Type III Pyridoxal 5e-40
cd06842423 cd06842, PLPDE_III_Y4yA_like, Type III Pyridoxal 5-phos 1e-33
cd06829346 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phospha 8e-05
pfam02784245 pfam02784, Orn_Arg_deC_N, Pyridoxal-dependent decarboxy 5e-58
cd06808211 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP 2e-38
cd06830409 cd06830, PLPDE_III_ADC, Type III Pyridoxal 5-phosphate 3e-20
TIGR01273 624 TIGR01273, speA, arginine decarboxylase, biosynthetic 2e-17
cd06831394 cd06831, PLPDE_III_ODC_like_AZI, Type III Pyridoxal 5-p 1e-10
PRK05354 634 PRK05354, PRK05354, arginine decarboxylase; Provisional 4e-10
PLN02439 559 PLN02439, PLN02439, arginine decarboxylase 2e-07
cd06840368 cd06840, PLPDE_III_Bif_AspK_DapDC, Type III Pyridoxal 5 9e-54
cd06843377 cd06843, PLPDE_III_PvsE_like, Type III Pyridoxal 5-phos 3e-44
pfam00278110 pfam00278, Orn_DAP_Arg_deC, Pyridoxal-dependent decarbo 2e-20
COG1166 652 COG1166, SpeA, Arginine decarboxylase (spermidine biosy 3e-17
cd00635222 cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-p 3e-06
COG0325228 COG0325, COG0325, Predicted enzyme with a TIM-barrel fo 4e-04
cd00430367 cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate ( 0.002
>gnl|CDD|162174 TIGR01048, lysA, diaminopimelate decarboxylase Back     alignment and domain information
>gnl|CDD|30369 COG0019, LysA, Diaminopimelate decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143485 cd06810, PLPDE_III_ODC_DapDC_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>gnl|CDD|178152 PLN02537, PLN02537, diaminopimelate decarboxylase Back     alignment and domain information
>gnl|CDD|183006 PRK11165, PRK11165, diaminopimelate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|181596 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>gnl|CDD|143501 cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase Back     alignment and domain information
>gnl|CDD|143506 cd06839, PLPDE_III_Btrk_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase Back     alignment and domain information
>gnl|CDD|143482 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase Back     alignment and domain information
>gnl|CDD|132143 TIGR03099, dCO2ase_PEP1, pyridoxal-dependent decarboxylase, exosortase system type 1 associated Back     alignment and domain information
>gnl|CDD|35841 KOG0622, KOG0622, KOG0622, Ornithine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE Back     alignment and domain information
>gnl|CDD|143505 cd06836, PLPDE_III_ODC_DapDC_like_1, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Uncharacterized Proteins with similarity to Ornithine and Diaminopimelate Decarboxylases Back     alignment and domain information
>gnl|CDD|143509 cd06842, PLPDE_III_Y4yA_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA Back     alignment and domain information
>gnl|CDD|143502 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase Back     alignment and domain information
>gnl|CDD|111657 pfam02784, Orn_Arg_deC_N, Pyridoxal-dependent decarboxylase, pyridoxal binding domain Back     alignment and domain information
>gnl|CDD|143484 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information
>gnl|CDD|143503 cd06830, PLPDE_III_ADC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase Back     alignment and domain information
>gnl|CDD|162279 TIGR01273, speA, arginine decarboxylase, biosynthetic Back     alignment and domain information
>gnl|CDD|143504 cd06831, PLPDE_III_ODC_like_AZI, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor Back     alignment and domain information
>gnl|CDD|180035 PRK05354, PRK05354, arginine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|178058 PLN02439, PLN02439, arginine decarboxylase Back     alignment and domain information
>gnl|CDD|143507 cd06840, PLPDE_III_Bif_AspK_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase Back     alignment and domain information
>gnl|CDD|143510 cd06843, PLPDE_III_PvsE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE Back     alignment and domain information
>gnl|CDD|144023 pfam00278, Orn_DAP_Arg_deC, Pyridoxal-dependent decarboxylase, C-terminal sheet domain Back     alignment and domain information
>gnl|CDD|31360 COG1166, SpeA, Arginine decarboxylase (spermidine biosynthesis) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143483 cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins Back     alignment and domain information
>gnl|CDD|30673 COG0325, COG0325, Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|143481 cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 431 diaminopimelate decarboxylase protein [Candidatus Liber
TIGR01048431 lysA diaminopimelate decarboxylase; InterPro: IPR002986 100.0
PRK11165412 diaminopimelate decarboxylase; Provisional 100.0
TIGR03099398 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosort 100.0
cd06828373 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-De 100.0
COG0019394 LysA Diaminopimelate decarboxylase [Amino acid transpor 100.0
cd06839382 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP 100.0
PRK08961865 bifunctional aspartate kinase/diaminopimelate decarboxy 100.0
cd06843377 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd06810368 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate 100.0
cd06840368 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate 100.0
cd06836379 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-phospha 100.0
cd06841379 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd00622362 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Depe 100.0
cd06842423 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd06830409 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP)-Depe 100.0
cd06831394 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate ( 100.0
cd06829346 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (PLP)-D 100.0
KOG0622448 consensus 100.0
TIGR01047403 nspC carboxynorspermidine decarboxylase; InterPro: IPR0 100.0
PRK05354634 arginine decarboxylase; Provisional 100.0
COG1166652 SpeA Arginine decarboxylase (spermidine biosynthesis) [ 100.0
cd06818382 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phosphate (P 99.91
cd06819358 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)- 99.9
cd06820353 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate ( 99.89
cd06821361 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dep 99.88
cd06812374 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphat 99.87
cd06817389 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP)-Depe 99.86
TIGR01273657 speA arginine decarboxylase; InterPro: IPR002985 Pyrido 99.83
cd06813388 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphat 99.82
PRK11930824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 99.69
COG3616368 Predicted amino acid aldolase or racemase [Amino acid t 99.68
cd06814379 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphat 99.66
cd06811382 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP 99.64
pfam02784245 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyrido 100.0
cd06808211 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dependen 100.0
pfam00278110 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-te 99.91
cd06815353 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP 99.81
cd00430367 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)-Depen 99.81
cd07376345 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate 99.76
PRK00053360 alr alanine racemase; Reviewed 99.71
PRK13340404 alanine racemase; Reviewed 99.7
cd06825368 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP)-Dep 99.66
PRK03646355 dadX alanine racemase; Reviewed 99.63
cd06826365 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Depe 99.62
cd06827354 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosphate 99.6
COG0787360 Alr Alanine racemase [Cell envelope biogenesis, outer m 99.6
COG3457353 Predicted amino acid racemase [Amino acid transport and 99.37
TIGR00492383 alr alanine racemase; InterPro: IPR000821 Alanine racem 99.35
pfam01168216 Ala_racemase_N Alanine racemase, N-terminal domain. 99.53
cd06824224 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding 98.88
cd00635222 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosphate ( 98.78
COG0325228 Predicted enzyme with a TIM-barrel fold [General functi 98.72
cd06822227 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-bindi 98.38
KOG3157244 consensus 97.72
TIGR00044250 TIGR00044 conserved hypothetical protein TIGR00044; Int 97.21
PRK07028429 bifunctional hexulose-6-phosphate synthase/ribonuclease 94.98
PRK03562615 glutathione-regulated potassium-efflux system protein K 94.49
PRK03659602 glutathione-regulated potassium-efflux system protein K 94.13
pfam01261201 AP_endonuc_2 Xylose isomerase-like TIM barrel. This TIM 90.46
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 90.44
>TIGR01048 lysA diaminopimelate decarboxylase; InterPro: IPR002986 Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , Back     alignment and domain information
>PRK11165 diaminopimelate decarboxylase; Provisional Back     alignment and domain information
>TIGR03099 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosortase system type 1 associated Back     alignment and domain information
>cd06828 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase Back     alignment and domain information
>COG0019 LysA Diaminopimelate decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06839 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>cd06843 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE Back     alignment and domain information
>cd06810 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>cd06840 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase Back     alignment and domain information
>cd06836 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Uncharacterized Proteins with similarity to Ornithine and Diaminopimelate Decarboxylases Back     alignment and domain information
>cd06841 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE Back     alignment and domain information
>cd00622 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase Back     alignment and domain information
>cd06842 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA Back     alignment and domain information
>cd06830 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase Back     alignment and domain information
>cd06831 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor Back     alignment and domain information
>cd06829 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase Back     alignment and domain information
>KOG0622 consensus Back     alignment and domain information
>TIGR01047 nspC carboxynorspermidine decarboxylase; InterPro: IPR005730 Carboxynorspermidine synthase, mediates the nicotinamide-nucleotide-linked reduction of the Schiff base H2N(CH2)3N = CHCH2CH(NH2)COOH Back     alignment and domain information
>PRK05354 arginine decarboxylase; Provisional Back     alignment and domain information
>COG1166 SpeA Arginine decarboxylase (spermidine biosynthesis) [Amino acid transport and metabolism] Back     alignment and domain information
>cd06818 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bacterial Cryptic D-Serine Dehydratase Back     alignment and domain information
>cd06819 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase Back     alignment and domain information
>cd06820 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like Back     alignment and domain information
>cd06821 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme D-Threonine Aldolase Back     alignment and domain information
>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1 Back     alignment and domain information
>cd06817 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Eukaryotic D-Serine Dehydratase Back     alignment and domain information
>TIGR01273 speA arginine decarboxylase; InterPro: IPR002985 Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , Back     alignment and domain information
>cd06813 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2 Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>COG3616 Predicted amino acid aldolase or racemase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06814 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 3 Back     alignment and domain information
>cd06811 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme yhfX Back     alignment and domain information
>pfam02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain Back     alignment and domain information
>cd06808 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information
>pfam00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain Back     alignment and domain information
>cd06815 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase-like 1 Back     alignment and domain information
>cd00430 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase Back     alignment and domain information
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase Back     alignment and domain information
>PRK00053 alr alanine racemase; Reviewed Back     alignment and domain information
>PRK13340 alanine racemase; Reviewed Back     alignment and domain information
>cd06825 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, VanT and similar proteins Back     alignment and domain information
>PRK03646 dadX alanine racemase; Reviewed Back     alignment and domain information
>cd06826 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2 Back     alignment and domain information
>cd06827 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases Back     alignment and domain information
>COG0787 Alr Alanine racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3457 Predicted amino acid racemase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00492 alr alanine racemase; InterPro: IPR000821 Alanine racemase catalyses the pyridoxal-dependent conversion of L-alanine into D-alanine, a key component of bacterial peptidoglycan Back     alignment and domain information
>pfam01168 Ala_racemase_N Alanine racemase, N-terminal domain Back     alignment and domain information
>cd06824 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins Back     alignment and domain information
>cd00635 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins Back     alignment and domain information
>COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd06822 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins Back     alignment and domain information
>KOG3157 consensus Back     alignment and domain information
>TIGR00044 TIGR00044 conserved hypothetical protein TIGR00044; InterPro: IPR011078 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>pfam01261 AP_endonuc_2 Xylose isomerase-like TIM barrel Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target431 diaminopimelate decarboxylase protein [Candidatus Liber
2p3e_A420 Crystal Structure Of Aq1208 From Aquifex Aeolicus L 3e-83
3n2b_A441 1.8 Angstrom Resolution Crystal Structure Of Diamin 5e-82
1twi_A434 Crystal Structure Of Diaminopimelate Decarboxylase 1e-74
1tuf_A434 Crystal Structure Of Diaminopimelate Decarboxylase 5e-73
3c5q_A425 Crystal Structure Of Diaminopimelate Decarboxylase 3e-67
2qgh_A396 Crystal Structure Of Diaminopimelate Decarboxylase 2e-64
1hkv_B447 Mycobacterium Diaminopimelate Dicarboxylase (Lysa) 3e-63
2yxx_A386 Crystal Structure Analysis Of Diaminopimelate Decar 1e-62
1hkw_A453 Mycobacterium Diaminopimelate Dicarboxylase (Lysa) 4e-62
2o0t_A467 The Three Dimensional Structure Of Diaminopimelate 2e-61
1knw_A425 Crystal Structure Of Diaminopimelate Decarboxylase 1e-55
2j66_A428 Structural Characterisation Of Btrk Decarboxylase F 1e-49
2oo0_A471 A Structural Insight Into The Inhibition Of Human A 2e-38
2on3_A461 A Structural Insight Into The Inhibition Of Human A 2e-38
1qu4_A425 Crystal Structure Of Trypanosoma Brucei Ornithine D 2e-38
1njj_A425 Crystal Structure Determination Of T. Brucei Ornith 2e-38
1szr_C425 A Dimer Interface Mutant Of Ornithine Decarboxylase 2e-38
7odc_A424 Crystal Structure Ornithine Decarboxylase From Mous 6e-38
1d7k_A421 Crystal Structure Of Human Ornithine Decarboxylase 8e-37
2tod_A425 Ornithine Decarboxylase From Trypanosoma Brucei K69 9e-37
2plj_A419 Crystal Structure Of LysineORNITHINE DECARBOXYLASE 2e-36
2nva_A372 The X-Ray Crystal Structure Of The Paramecium Bursa 2e-30
2nv9_A372 The X-Ray Crystal Structure Of The Paramecium Bursa 2e-30
3btn_A448 Crystal Structure Of Antizyme Inhibitor, An Ornithi 2e-28
3n29_A418 Crystal Structure Of Carboxynorspermidine Decarboxy 6e-24
3mt1_A365 Crystal Structure Of Putative Carboxynorspermidine 2e-23
gi|146386677|pdb|2P3E|A Chain A, Crystal Structure Of Aq1208 From Aquifex Aeolicus Length = 420 Back     alignment and structure
 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 178/410 (43%), Positives = 252/410 (61%), Gaps = 4/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
             +Y +G L  E VSL++LA    TP Y YS+  I++ +  +  AF   D ++CYA+KAN
Sbjct: 10  YLEYRDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFP--DALICYAVKAN 67

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
            N  ++K L  LG+G DIVS GEL  A  A +P ERIV++GVGKT  E+  A+ S I  F
Sbjct: 68  FNPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMF 127

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LN+ A  LGKKA IA RVNPD++  TH  I+TG ++ KFG+ I +    Y
Sbjct: 128 NVESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIREAQKEY 187

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YAS L  ++I G+  HIGSQI  I  + +A + +  L + L   G +I+++D+GGGLGI
Sbjct: 188 EYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQKGFDIKYLDIGGGLGI 247

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  + + P+  D A L+     N++ KIILEPGR ++ + GIL+T+V  +K    K F+
Sbjct: 248 KYKPEDKEPAPQDLADLLKDLLENVKAKIILEPGRSIMGNAGILITQVQFLKDKGSKHFI 307

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D  MND +RP++Y+AYH I  +     +R  + ADIVGPICETGDF+AL+R+I   + 
Sbjct: 308 IVDAGMNDLIRPSIYNAYHHIIPVE--TKERKKVVADIVGPICETGDFLALDREIEEVQR 365

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           G+ L +   GAYG   S  YN R    E++V      +IR R  +  ++E
Sbjct: 366 GEYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVE 415


>gi|297787806|pdb|3N2B|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Diaminopimelate Decarboxylase (Lysa) From Vibrio Cholerae. Length = 441 Back     alignment and structure
>gi|51247766|pdb|1TWI|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschii In Co-Complex With L-Lysine Length = 434 Back     alignment and structure
>gi|51247744|pdb|1TUF|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschi Length = 434 Back     alignment and structure
>gi|313507304|pdb|3C5Q|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase (I148l Mutant) From Helicobacter Pylori Complexed With L-Lysine Length = 425 Back     alignment and structure
>gi|159795662|pdb|2YXX|A Chain A, Crystal Structure Analysis Of Diaminopimelate Decarboxylate (Lysa) Length = 386 Back     alignment and structure
>gi|29726282|pdb|1HKW|A Chain A, Mycobacterium Diaminopimelate Dicarboxylase (Lysa) Length = 453 Back     alignment and structure
>gi|134105016|pdb|2O0T|A Chain A, The Three Dimensional Structure Of Diaminopimelate Decarboxylase From Mycobacterium Tuberculosis Reveals A Tetrameric Enzyme Organisation Length = 467 Back     alignment and structure
>gi|39654106|pdb|1KNW|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase Length = 425 Back     alignment and structure
>gi|116668430|pdb|2J66|A Chain A, Structural Characterisation Of Btrk Decarboxylase From Butirosin Biosynthesis Length = 428 Back     alignment and structure
>gi|152149219|pdb|2OO0|A Chain A, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 471 Back     alignment and structure
gi|152149217|pdb|2ON3|A Chain A, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 461 Back     alignment and structure
>gi|6573538|pdb|1QU4|A Chain A, Crystal Structure Of Trypanosoma Brucei Ornithine Decarboxylase Length = 425 Back     alignment and structure
>gi|34810213|pdb|1NJJ|A Chain A, Crystal Structure Determination Of T. Brucei Ornithine Decarboxylase Bound To D-Ornithine And To G418 Length = 425 Back     alignment and structure
>gi|56553801|pdb|1SZR|C Chain C, A Dimer Interface Mutant Of Ornithine Decarboxylase Reveals Structure Of Gem Diamine Intermediate Length = 425 Back     alignment and structure
>gi|6435612|pdb|7ODC|A Chain A, Crystal Structure Ornithine Decarboxylase From Mouse, Truncated 37 Residues From The C-Terminus, To 1.6 Angstrom Resolution Length = 424 Back     alignment and structure
>gi|11514289|pdb|1D7K|A Chain A, Crystal Structure Of Human Ornithine Decarboxylase At 2.1 Angstroms Resolution Length = 421 Back     alignment and structure
>gi|6573548|pdb|2TOD|A Chain A, Ornithine Decarboxylase From Trypanosoma Brucei K69a Mutant In Complex With Alpha-Difluoromethylornithine Length = 425 Back     alignment and structure
>gi|152149342|pdb|2PLJ|A Chain A, Crystal Structure Of LysineORNITHINE DECARBOXYLASE Complexed With Putrescine From Vibrio Vulnificus Length = 419 Back     alignment and structure
gi|145579908|pdb|2NVA|A Chain A, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Bound To Agmatine Length = 372 Back     alignment and structure
>gi|145579900|pdb|2NV9|A Chain A, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Length = 372 Back     alignment and structure
gi|183448303|pdb|3BTN|A Chain A, Crystal Structure Of Antizyme Inhibitor, An Ornithine Decarboxylase Homologous Protein Length = 448 Back     alignment and structure
>gi|297787804|pdb|3N29|A Chain A, Crystal Structure Of Carboxynorspermidine Decarboxylase Comp Norspermidine From Campylobacter Jejuni Length = 418 Back     alignment and structure
>gi|299856844|pdb|3MT1|A Chain A, Crystal Structure Of Putative Carboxynorspermidine Decarboxylase Protein From Sinorhizobium Meliloti Length = 365 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target431 diaminopimelate decarboxylase protein [Candidatus Liber
3n2b_A441 Diaminopimelate decarboxylase; LYSA, lyase, structural 1e-113
1f3t_A425 ODC, ornithine decarboxylase; beta-alpha-barrel, modifi 5e-88
3n29_A418 Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1. 4e-87
1knw_A425 Diaminopimelate decarboxylase; pyridoxal-phosphate, dec 6e-85
2p3e_A420 Diaminopimelate decarboxylase; southeast collaboratory 4e-84
2qgh_A425 Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.3 2e-79
1twi_A434 Diaminopimelate decarboxylase; antibiotic resistance, l 1e-75
2o0t_A467 Diaminopimelate decarboxylase; PLP binding enzyme, lysi 6e-74
2oo0_A471 ODC, ornithine decarboxylase; beta-alpha barrel, sheet, 5e-73
3mt1_A365 Putative carboxynorspermidine decarboxylase prote; PSI2 1e-71
2yxx_A386 Diaminopimelate decarboxylase; TM1517, TIM beta/alpha b 2e-67
7odc_A424 Protein (ornithine decarboxylase); pyridoxal-5'-phospha 7e-67
3btn_A448 Antizyme inhibitor 1; TIM-like A/B barrel domain and A 4e-65
2plj_A419 Lysine/ornithine decarboxylase; type IV decarboxylase, 1e-62
2j66_A428 BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyas 1e-62
2nva_A372 Arginine decarboxylase, A207R protein; PLP, TIM barrel, 5e-57
3nzp_A 619 Arginine decarboxylase; alpha-beta protein, structural 2e-71
3nzq_A 666 ADC, biosynthetic arginine decarboxylase; alpha-beta pr 2e-62
3n2o_A 648 ADC, biosynthetic arginine decarboxylase; lyase; HET: P 2e-61
3llx_A376 Predicted amino acid aldolase or racemase; structural g 8e-07
3gwq_A426 D-serine deaminase; YP_556991.1, structural genomics, j 3e-04
>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Length = 441 Back     alignment and structure
 Score =  402 bits (1035), Expect = e-113
 Identities = 182/418 (43%), Positives = 255/418 (61%), Gaps = 4/418 (0%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 25  MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 84

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 85  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 144

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 145 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 204

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 205 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 264

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y  +  P  S    +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  K
Sbjct: 265 LGVVYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHK 324

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R + L
Sbjct: 325 NFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEA--QTYDLVGPVCETSDFLGKDRDLVL 382

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
            + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+ 
Sbjct: 383 -QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVL 439


>1f3t_A ODC, ornithine decarboxylase; beta-alpha-barrel, modified greek KEY beta-sheet, lyase; HET: PLP; 2.00A {Trypanosoma brucei} SCOP: b.49.2.3 c.1.6.1 PDB: 1qu4_A* 1szr_C* 2tod_A* 1njj_A* Length = 425 Back     alignment and structure
>3n29_A Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1.90A {Campylobacter jejuni subsp} Length = 418 Back     alignment and structure
>1knw_A Diaminopimelate decarboxylase; pyridoxal-phosphate, decarboxylation, lysine, TIM-barrel, lyase; HET: PLP MES; 2.10A {Escherichia coli} SCOP: b.49.2.3 c.1.6.1 PDB: 1ko0_A* Length = 425 Back     alignment and structure
>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for structural genomics, riken spring-8 center, riken genomic sciences center; 1.99A {Aquifex aeolicus VF5} Length = 420 Back     alignment and structure
>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A {Helicobacter pylori} PDB: 3c5q_A* Length = 425 Back     alignment and structure
>1twi_A Diaminopimelate decarboxylase; antibiotic resistance, lysine biosynthesis, structural genomics, NYSGXRC, PSI; HET: LYS PLP; 2.00A {Methanocaldococcus jannaschii} SCOP: b.49.2.3 c.1.6.1 PDB: 1tuf_A* Length = 434 Back     alignment and structure
>2o0t_A Diaminopimelate decarboxylase; PLP binding enzyme, lysine biosynthesis, structural genomics, TB structural genomics consortium; HET: LLP; 2.33A {Mycobacterium tuberculosis H37RV} PDB: 1hkv_A* 1hkw_A Length = 467 Back     alignment and structure
>2oo0_A ODC, ornithine decarboxylase; beta-alpha barrel, sheet, lyase; HET: PLP; 1.90A {Homo sapiens} Length = 471 Back     alignment and structure
>3mt1_A Putative carboxynorspermidine decarboxylase prote; PSI2, MCSG, structural genomics; 2.50A {Sinorhizobium meliloti} Length = 365 Back     alignment and structure
>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold, lyase, structural genomics, NPPSFA; HET: PLP; 1.70A {Thermotoga maritima MSB8} Length = 386 Back     alignment and structure
>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP, group IV decarboxylase, polyamines, parasitical, chemotherapy target, putrescine; HET: PLP; 1.60A {Mus musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A* Length = 424 Back     alignment and structure
>3btn_A Antizyme inhibitor 1; TIM-like A/B barrel domain and A sheet domain, structural genomics, israel structural proteomics center, ISPC; 2.05A {Mus musculus} Length = 448 Back     alignment and structure
>2plj_A Lysine/ornithine decarboxylase; type IV decarboxylase, beta/alpha barrel, beta barrel, lyase; HET: P3T; 1.70A {Vibrio vulnificus CMCP6} PDB: 2plk_A* Length = 419 Back     alignment and structure
>2j66_A BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP; 1.65A {Bacillus circulans} Length = 428 Back     alignment and structure
>2nva_A Arginine decarboxylase, A207R protein; PLP, TIM barrel, eukaryotic ODC- like, lyase; HET: PL2; 1.80A {Paramecium bursaria chlorella virus 1} PDB: 2nv9_A* Length = 372 Back     alignment and structure
>3nzp_A Arginine decarboxylase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: PLP; 3.00A {Campylobacter jejuni subsp} Length = 619 Back     alignment and structure
>3nzq_A ADC, biosynthetic arginine decarboxylase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.10A {Escherichia coli} Length = 666 Back     alignment and structure
>3n2o_A ADC, biosynthetic arginine decarboxylase; lyase; HET: PLP; 2.30A {Vibrio vulnificus} Length = 648 Back     alignment and structure
>3llx_A Predicted amino acid aldolase or racemase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: LLP TRS; 1.50A {Idiomarina loihiensis} Length = 376 Back     alignment and structure
>3gwq_A D-serine deaminase; YP_556991.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Burkholderia xenovorans LB400} Length = 426 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target431 diaminopimelate decarboxylase protein [Candidatus Liber
3n2b_A441 Diaminopimelate decarboxylase; LYSA, lyase, structural 100.0
2p3e_A420 Diaminopimelate decarboxylase; southeast collaboratory 100.0