254780372

254780372

flagellar biosynthesis protein FliP

GeneID in NCBI database:8209357Locus tag:CLIBASIA_01285
Protein GI in NCBI database:254780372Protein Accession:YP_003064785.1
Gene range:-(271164, 271904)Protein Length:246aa
Gene description:flagellar biosynthesis protein FliP
COG prediction:[N] [U] Flagellar biosynthesis pathway, component FliP
KEGG prediction:fliP; flagellar biosynthesis protein FliP; K02419 flagellar biosynthetic protein FliP
SEED prediction:Flagellar biosynthesis protein FliP
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
cHHHHHHHHHHHHHHHHHHccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHccHHHHHHHHHcHHHHHHHHHHHHcccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHEHcHHHHHHHHHHHccc
MIRYCFFALFLVTPElvfaksslhdvmnipadlsiSTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRtgmgmgsvppNLVIISLALFMTFYVmsptldrsiemgiqplmnnqitettAIQRVAEPFWVFMRNNTREKDLSLFMDMahsshrntditkndhieyrILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGmmmlpptsislpfKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHsshrntditkndhiEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSfeigfliilpfliidmiVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
*IRYCFFALFLVTPELVFAKS****************WIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH************HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI
MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target246 flagellar biosynthesis protein FliP [Candidatus Liberib
315121841246 flagellar biosynthesis protein FliP [Candidatus Liberib 1 1e-120
86356318245 flagellar biosynthesis protein FliP [Rhizobium etli CFN 1 1e-87
116250488245 flagellar biosynthesis protein FliP [Rhizobium legumino 1 2e-87
190890369245 flagellar biosynthesis transmembrane protein [Rhizobium 1 3e-87
209547934245 flagellar biosynthesis protein FliP [Rhizobium legumino 1 5e-87
218460348245 flagellar biosynthesis protein FliP [Rhizobium etli Kim 1 6e-87
222084871252 flagellar biosynthesis transmembrane protein [Agrobacte 1 2e-82
15887892245 flagellar biosynthesis protein FliP [Agrobacterium tume 1 1e-81
222147577245 flagellar biosynthesis protein FliP [Agrobacterium viti 1 2e-81
325291933245 flagellar biosynthesis protein FliP [Agrobacterium sp. 1 2e-80
>gi|315121841|ref|YP_004062330.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 246 Back     alignment and organism information
 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/246 (85%), Positives = 232/246 (94%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           MIRY FF  F V PE VFA+SSLHD+M IP +LS+STWIVRTFG+FTILSI PILLIMVT
Sbjct: 1   MIRYLFFGFFFVVPESVFAQSSLHDIMEIPPNLSVSTWIVRTFGLFTILSIVPILLIMVT 60

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFPRFIIVFSILRTGMGMGS+PPNLVIISLALFMTFYVMSPTLDRSIEMG+QPL++N+IT
Sbjct: 61  CFPRFIIVFSILRTGMGMGSIPPNLVIISLALFMTFYVMSPTLDRSIEMGVQPLISNKIT 120

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
           ET AI+R+AEPFW+FM+NNTREKDL LFM+MA S+H+NTDI K+DHIEYRILIPSFMISE
Sbjct: 121 ETVAIKRIAEPFWIFMKNNTREKDLFLFMEMAKSTHKNTDIKKDDHIEYRILIPSFMISE 180

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK+IFFVLIDGW LLVEN
Sbjct: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKIIFFVLIDGWGLLVEN 240

Query: 241 LVKSFI 246
           LV+SF+
Sbjct: 241 LVRSFV 246


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356318|ref|YP_468210.1| flagellar biosynthesis protein FliP [Rhizobium etli CFN 42] Length = 245 Back     alignment and organism information
>gi|116250488|ref|YP_766326.1| flagellar biosynthesis protein FliP [Rhizobium leguminosarum bv. viciae 3841] Length = 245 Back     alignment and organism information
>gi|190890369|ref|YP_001976911.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT 652] Length = 245 Back     alignment and organism information
>gi|209547934|ref|YP_002279851.1| flagellar biosynthesis protein FliP [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 245 Back     alignment and organism information
>gi|218460348|ref|ZP_03500439.1| flagellar biosynthesis protein FliP [Rhizobium etli Kim 5] Length = 245 Back     alignment and organism information
>gi|222084871|ref|YP_002543400.1| flagellar biosynthesis transmembrane protein [Agrobacterium radiobacter K84] Length = 252 Back     alignment and organism information
>gi|15887892|ref|NP_353573.1| flagellar biosynthesis protein FliP [Agrobacterium tumefaciens str. C58] Length = 245 Back     alignment and organism information
>gi|222147577|ref|YP_002548534.1| flagellar biosynthesis protein FliP [Agrobacterium vitis S4] Length = 245 Back     alignment and organism information
>gi|325291933|ref|YP_004277797.1| flagellar biosynthesis protein FliP [Agrobacterium sp. H13-3] Length = 245 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target246 flagellar biosynthesis protein FliP [Candidatus Liberib
PRK05699245 PRK05699, fliP, flagellar biosynthesis protein FliP; Re 4e-75
PRK12783255 PRK12783, fliP, flagellar biosynthesis protein FliP; Re 3e-67
TIGR01103197 TIGR01103, fliP, flagellar biosynthetic protein FliP 1e-64
COG1338248 COG1338, FliP, Flagellar biosynthesis pathway, componen 1e-61
PRK12430379 PRK12430, PRK12430, putative bifunctional flagellar bio 3e-45
PRK12797213 PRK12797, PRK12797, type III secretion system protein Y 4e-45
TIGR01102202 TIGR01102, yscR, type III secretion apparatus protein, 4e-38
PRK09617243 PRK09617, PRK09617, type III secretion system protein; 6e-37
COG4790214 COG4790, EscR, Type III secretory pathway, component Es 8e-37
PRK12796221 PRK12796, spaP, type III secretion system protein SpaP; 1e-25
pfam00813194 pfam00813, FliP, FliP family 3e-67
>gnl|CDD|180209 PRK05699, fliP, flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>gnl|CDD|171720 PRK12783, fliP, flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>gnl|CDD|130173 TIGR01103, fliP, flagellar biosynthetic protein FliP Back     alignment and domain information
>gnl|CDD|31529 COG1338, FliP, Flagellar biosynthesis pathway, component FliP [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|105645 PRK12430, PRK12430, putative bifunctional flagellar biosynthesis protein FliO/FliP; Provisional Back     alignment and domain information
>gnl|CDD|183754 PRK12797, PRK12797, type III secretion system protein YscR; Provisional Back     alignment and domain information
>gnl|CDD|130172 TIGR01102, yscR, type III secretion apparatus protein, YscR/HrcR family Back     alignment and domain information
>gnl|CDD|181994 PRK09617, PRK09617, type III secretion system protein; Reviewed Back     alignment and domain information
>gnl|CDD|34400 COG4790, EscR, Type III secretory pathway, component EscR [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|183753 PRK12796, spaP, type III secretion system protein SpaP; Provisional Back     alignment and domain information
>gnl|CDD|144419 pfam00813, FliP, FliP family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 246 flagellar biosynthesis protein FliP [Candidatus Liberib
TIGR01103202 fliP flagellar biosynthetic protein FliP; InterPro: IPR 100.0
PRK05699245 fliP flagellar biosynthesis protein FliP; Reviewed 100.0
PRK09617305 type III secretion system protein; Reviewed 100.0
PRK12797215 type III secretion system protein; Provisional 100.0
TIGR01102209 yscR type III secretion apparatus protein, YscR/HrcR fa 100.0
PRK12796219 spaP surface presentation of antigens protein SpaP; Pro 100.0
pfam00813194 FliP FliP family. 100.0
COG4790214 EscR Type III secretory pathway, component EscR [Intrac 100.0
PRK12783252 fliP flagellar biosynthesis protein FliP; Reviewed 100.0
PRK12430379 type III secretion system protein; Provisional 100.0
COG1338248 FliP Flagellar biosynthesis pathway, component FliP [Ce 100.0
PRK12772 609 bifunctional flagellar biosynthesis protein FliR/FlhB; 95.94
PRK05701250 fliR flagellar biosynthesis protein FliR; Reviewed 94.99
PRK12780250 fliR flagellar biosynthesis protein FliR; Reviewed 93.94
pfam01311249 Bac_export_1 Bacterial export proteins, family 1. This 92.93
>TIGR01103 fliP flagellar biosynthetic protein FliP; InterPro: IPR005837 This model describes bacterial flagellar biogenesis protein fliP, which is one of the genes within the motility locus on the bacterial chromosome that is involved in structure and function of bacterial flagellum Back     alignment and domain information
>PRK05699 fliP flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>PRK09617 type III secretion system protein; Reviewed Back     alignment and domain information
>PRK12797 type III secretion system protein; Provisional Back     alignment and domain information
>TIGR01102 yscR type III secretion apparatus protein, YscR/HrcR family; InterPro: IPR005773 This model identifies the generic virulence translocation proteins in bacteria Back     alignment and domain information
>PRK12796 spaP surface presentation of antigens protein SpaP; Provisional Back     alignment and domain information
>pfam00813 FliP FliP family Back     alignment and domain information
>COG4790 EscR Type III secretory pathway, component EscR [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12783 fliP flagellar biosynthesis protein FliP; Reviewed Back     alignment and domain information
>PRK12430 type III secretion system protein; Provisional Back     alignment and domain information
>COG1338 FliP Flagellar biosynthesis pathway, component FliP [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional Back     alignment and domain information
>PRK05701 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>PRK12780 fliR flagellar biosynthesis protein FliR; Reviewed Back     alignment and domain information
>pfam01311 Bac_export_1 Bacterial export proteins, family 1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00