254780373

254780373

flagellar basal body-associated protein FliL

GeneID in NCBI database:8209358Locus tag:CLIBASIA_01290
Protein GI in NCBI database:254780373Protein Accession:YP_003064786.1
Gene range:-(271901, 272419)Protein Length:172aa
Gene description:flagellar basal body-associated protein FliL
COG prediction:none
KEGG prediction:fliL; flagellar basal body-associated protein FliL; K02415 flagellar FliL protein
SEED prediction:Flagellar biosynthesis protein fliL
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
ccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccEEEEEHHHHHHccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcc
ccHcccccHHHHccHHHHHEEEHHHHHHHHHHHHHHHHHEEcccccccccHHHHHcHHHccHHHHHHHcccccccccccccEEEccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEc
msyddttsqyirgnQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNnfydnsvrsvhtgdtislkklqifslqpiitnfdsspkdwLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
msyddttsqyirgnqHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERvklrsqgfvssvifrtfiia
MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
********************TWFVVYTFIGIFCGWLGGIVML************************************KLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
********QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
****DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target172 flagellar basal body-associated protein FliL [Candidatu
315121842170 flagellar basal body-associated protein FliL [Candidatu 1 4e-57
209547933168 flagellar basal body-associated protein FliL [Rhizobium 1 9e-25
307318917163 flagellar basal body-associated protein FliL [Sinorhizo 1 2e-24
150395490163 flagellar basal body-associated protein FliL [Sinorhizo 1 4e-24
15964420163 flagellar transmembrane protein [Sinorhizobium meliloti 1 6e-24
116250487168 FliL flagella related protein [Rhizobium leguminosarum 1 6e-24
241203111168 flagellar basal body-associated protein FliL [Rhizobium 1 7e-24
86356317168 flagellar biosynthesis transmembrane protein [Rhizobium 1 1e-23
218679633150 orfc; method: conceptual translation supplied by author 1 2e-23
227820863163 putative flagellar basal body-associated protein FliL [ 1 3e-23
>gi|315121842|ref|YP_004062331.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170 Back     alignment and organism information
 Score =  224 bits (570), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 133/173 (76%), Gaps = 4/173 (2%)

Query: 1   MSYDDTTSQYIRGNQ-HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           MSY+D     IRGNQ ++ F+  F+V T IGIFCGWLGGIV+      +K+E   + I  
Sbjct: 1   MSYNDKN---IRGNQSYERFIMQFIVCTAIGIFCGWLGGIVISSFVLAEKKENSIESIFK 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
           N Y+N  RS++  D +  K  QIF+L PIITNFDSSP++WLRLD+ALIC   P+KVFLE 
Sbjct: 58  NVYNNRTRSIYANDAVYPKDPQIFALHPIITNFDSSPENWLRLDVALICDKTPNKVFLEI 117

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           LHQDIMAY+RTVS+K ITG+QGFRYFKED+EERVKLR+QG VS+VIFRTFIIA
Sbjct: 118 LHQDIMAYVRTVSMKHITGSQGFRYFKEDVEERVKLRAQGSVSNVIFRTFIIA 170


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547933|ref|YP_002279850.1| flagellar basal body-associated protein FliL [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 168 Back     alignment and organism information
>gi|307318917|ref|ZP_07598348.1| flagellar basal body-associated protein FliL [Sinorhizobium meliloti AK83] Length = 163 Back     alignment and organism information
>gi|150395490|ref|YP_001325957.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae WSM419] Length = 163 Back     alignment and organism information
>gi|15964420|ref|NP_384773.1| flagellar transmembrane protein [Sinorhizobium meliloti 1021] Length = 163 Back     alignment and organism information
>gi|116250487|ref|YP_766325.1| FliL flagella related protein [Rhizobium leguminosarum bv. viciae 3841] Length = 168 Back     alignment and organism information
>gi|241203111|ref|YP_002974207.1| flagellar basal body-associated protein FliL [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 168 Back     alignment and organism information
>gi|86356317|ref|YP_468209.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN 42] Length = 168 Back     alignment and organism information
>gi|218679633|ref|ZP_03527530.1| orfc; method: conceptual translation supplied by author (flil) [Rhizobium etli CIAT 894] Length = 150 Back     alignment and organism information
>gi|227820863|ref|YP_002824833.1| putative flagellar basal body-associated protein FliL [Sinorhizobium fredii NGR234] Length = 163 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 flagellar basal body-associated protein FliL [Candidatu
pfam03748145 pfam03748, FliL, Flagellar basal body-associated protei 1e-06
>gnl|CDD|146406 pfam03748, FliL, Flagellar basal body-associated protein FliL Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 172 flagellar basal body-associated protein FliL [Candidatu
PRK08455180 fliL flagellar basal body-associated protein FliL; Revi 100.0
PRK05696168 fliL flagellar basal body-associated protein FliL; Revi 100.0
PRK12785167 fliL flagellar basal body-associated protein FliL; Revi 100.0
PRK07021159 fliL flagellar basal body-associated protein FliL; Revi 100.0
PRK07718142 fliL flagellar basal body-associated protein FliL; Revi 99.97
COG1580159 FliL Flagellar basal body-associated protein [Cell moti 99.97
pfam03748145 FliL Flagellar basal body-associated protein FliL. This 99.97
PRK05697135 flagellar basal body-associated protein FliL-like prote 99.92
PRK06654177 fliL flagellar basal body-associated protein FliL; Revi 99.54
TIGR02837172 spore_II_R stage II sporulation protein R; InterPro: IP 91.84
PRK08455180 fliL flagellar basal body-associated protein FliL; Revi 96.89
PRK12785167 fliL flagellar basal body-associated protein FliL; Revi 95.36
PRK07021159 fliL flagellar basal body-associated protein FliL; Revi 94.62
PRK10920 389 putative uroporphyrinogen III C-methyltransferase; Prov 94.39
PRK05696168 fliL flagellar basal body-associated protein FliL; Revi 90.72
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion] Back     alignment and domain information
>pfam03748 FliL Flagellar basal body-associated protein FliL Back     alignment and domain information
>PRK05697 flagellar basal body-associated protein FliL-like protein; Validated Back     alignment and domain information
>PRK06654 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>TIGR02837 spore_II_R stage II sporulation protein R; InterPro: IPR014202 This entry is designated stage II sporulation protein R Back     alignment and domain information
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 flagellar basal body-associated protein FliL [Candidatu
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 3e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 40.0 bits (92), Expect = 3e-04
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 11/34 (32%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK 109
           +LKKLQ  SL+ +  + DS+P        AL  K
Sbjct: 21  ALKKLQA-SLK-LYAD-DSAP--------ALAIK 43


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00