254780374

254780374

flagellar basal body L-ring protein

GeneID in NCBI database:8209359Locus tag:CLIBASIA_01295
Protein GI in NCBI database:254780374Protein Accession:YP_003064787.1
Gene range:-(272438, 273154)Protein Length:238aa
Gene description:flagellar basal body L-ring protein
COG prediction:[N] Flagellar basal body L-ring protein
KEGG prediction:flgH; flagellar basal body L-ring protein; K02393 flagellar L-ring protein precursor FlgH
SEED prediction:Flagellar L-ring protein FlgH
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
cHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEcccEEEEEEEEEEcHHHcccccEEEHHHEEEEEEEEEEEEEEEcccccHHHHHHHHHHccc
ccHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEcEEEEEEccccEEEEEEEEEcccccccccccccHHHHHEEEEEcccccHHHHHcccHHHHHHHccccc
MYRYSFIVLCYSSLlfgchssiseitgipqmspmgssldennrmpflgidfknsdstkksYSLWRDSHAalfkdsralnvgdiltvdiriddqavfdnqtgrsrnnslhrklsggfslfgqqtpqmngnlnydgggassgkgsiSRAEKLNLLIAAIVTAILENgnliisgsqevrvNDEIRSlnvtgivrpqdvdahnsvsyDKIAEARIsyggkgrttellrppighqlienlspl
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAalfkdsralnvGDILTVDIRIDDQavfdnqtgrsrnnslHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNvtgivrpqdvdahnsvsydKIAEArisyggkgrttellrppighqlienlspl
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDgggassgkgsisRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
*YRYSFIVLCYSSLLFGCHSSISEIT***************************************DSHAALFKDSRALNVGDILTVDIR**************************FSLFGQQTP***************************LLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDD********************SGGFSLFGQQTPQMNGNLNY*******G******AEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target238 flagellar basal body L-ring protein [Candidatus Liberib
315121843239 flagellar basal body L-ring protein [Candidatus Liberib 1 6e-99
222147575237 flagellar basal body L-ring protein [Agrobacterium viti 1 5e-66
86356316238 flagellar basal body L-ring protein [Rhizobium etli CFN 1 2e-62
116250486238 flagellar basal body L-ring protein [Rhizobium legumino 1 3e-62
209547932238 flagellar basal body L-ring protein [Rhizobium legumino 1 7e-62
241203110238 flagellar basal body L-ring protein [Rhizobium legumino 1 8e-62
150395489236 flagellar basal body L-ring protein [Sinorhizobium medi 1 8e-61
12057225236 FlgH [Sinorhizobium meliloti] Length = 236 1 9e-61
15964419236 flagellar basal body L-ring protein [Sinorhizobium meli 1 9e-61
307318916236 flagellar L-ring protein [Sinorhizobium meliloti AK83] 1 2e-60
>gi|315121843|ref|YP_004062332.1| flagellar basal body L-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 239 Back     alignment and organism information
 Score =  364 bits (934), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 181/239 (75%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MYRYSFIVLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           MYRYS I+LC   LL GCH    SEITG PQMSP+GSSL+++ R+   GIDFKN  +TKK
Sbjct: 1   MYRYSVIILCNILLLAGCHLGRFSEITGSPQMSPIGSSLNQHRRILLSGIDFKNPRATKK 60

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           SYSLWRDS++ LFKDSRALNVGDILTVDI+IDDQAVFDN+TGRSR+NSLH+KLSGGFS+F
Sbjct: 61  SYSLWRDSNSTLFKDSRALNVGDILTVDIKIDDQAVFDNKTGRSRDNSLHKKLSGGFSIF 120

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G+ +P M+ + NYDG   S GKGSISRAEKLN+LIAAIVT ILENGNLIISGSQEV VND
Sbjct: 121 GKNSPGMSADANYDGKSTSVGKGSISRAEKLNILIAAIVTEILENGNLIISGSQEVCVND 180

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+RSLNV GIVRPQDVDA+N VSYDKIAEARISYGGKG TTELL+ PIG +LI++ SPL
Sbjct: 181 EMRSLNVAGIVRPQDVDANNIVSYDKIAEARISYGGKGTTTELLKTPIGQRLIDSFSPL 239


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147575|ref|YP_002548532.1| flagellar basal body L-ring protein [Agrobacterium vitis S4] Length = 237 Back     alignment and organism information
>gi|86356316|ref|YP_468208.1| flagellar basal body L-ring protein [Rhizobium etli CFN 42] Length = 238 Back     alignment and organism information
>gi|116250486|ref|YP_766324.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv. viciae 3841] Length = 238 Back     alignment and organism information
>gi|209547932|ref|YP_002279849.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 238 Back     alignment and organism information
>gi|241203110|ref|YP_002974206.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 238 Back     alignment and organism information
>gi|150395489|ref|YP_001325956.1| flagellar basal body L-ring protein [Sinorhizobium medicae WSM419] Length = 236 Back     alignment and organism information
>gi|12057225|gb|AAB81417.2| FlgH [Sinorhizobium meliloti] Length = 236 Back     alignment and organism information
>gi|15964419|ref|NP_384772.1| flagellar basal body L-ring protein [Sinorhizobium meliloti 1021] Length = 236 Back     alignment and organism information
>gi|307318916|ref|ZP_07598347.1| flagellar L-ring protein [Sinorhizobium meliloti AK83] Length = 236 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target238 flagellar basal body L-ring protein [Candidatus Liberib
PRK00249222 PRK00249, flgH, flagellar basal body L-ring protein; Re 1e-57
COG2063230 COG2063, FlgH, Flagellar basal body L-ring protein [Cel 3e-47
PRK12788234 PRK12788, flgH, flagellar basal body L-ring protein; Re 5e-45
PRK12696236 PRK12696, flgH, flagellar basal body L-ring protein; Re 3e-21
PRK12701230 PRK12701, flgH, flagellar basal body L-ring protein; Re 3e-16
PRK12698224 PRK12698, flgH, flagellar basal body L-ring protein; Re 6e-18
PRK12407221 PRK12407, flgH, flagellar basal body L-ring protein; Re 1e-15
PRK12700230 PRK12700, flgH, flagellar basal body L-ring protein; Re 2e-15
PRK12697226 PRK12697, flgH, flagellar basal body L-ring protein; Re 3e-15
PRK12699246 PRK12699, flgH, flagellar basal body L-ring protein; Re 2e-10
pfam02107181 pfam02107, FlgH, Flagellar L-ring protein 4e-49
>gnl|CDD|178946 PRK00249, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|32246 COG2063, FlgH, Flagellar basal body L-ring protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|171723 PRK12788, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|171670 PRK12696, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|183691 PRK12701, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|183690 PRK12698, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|183507 PRK12407, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|139164 PRK12700, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|183689 PRK12697, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|105864 PRK12699, flgH, flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|145324 pfam02107, FlgH, Flagellar L-ring protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 238 flagellar basal body L-ring protein [Candidatus Liberib
PRK12701230 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK00249231 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12696238 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12788231 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12698224 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12407220 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12697227 flgH flagellar basal body L-ring protein; Reviewed 100.0
PRK12699246 flgH flagellar basal body L-ring protein; Reviewed 100.0
COG2063230 FlgH Flagellar basal body L-ring protein [Cell motility 100.0
PRK12700230 flgH flagellar basal body L-ring protein; Reviewed 100.0
pfam02107181 FlgH Flagellar L-ring protein. 100.0
PRK11627192 hypothetical protein; Provisional 94.86
PRK09837 460 copper/silver efflux system outer membrane protein CusC 91.49
PRK00022203 lolB outer membrane lipoprotein LolB; Provisional 90.98
TIGR02747174 TraV type IV conjugative transfer system protein TraV; 90.43
PRK09915 488 putative outer membrane efflux protein MdtP; Provisiona 90.19
>PRK12701 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK00249 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12788 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12407 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12697 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK12699 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>COG2063 FlgH Flagellar basal body L-ring protein [Cell motility and secretion] Back     alignment and domain information
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>pfam02107 FlgH Flagellar L-ring protein Back     alignment and domain information
>PRK11627 hypothetical protein; Provisional Back     alignment and domain information
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional Back     alignment and domain information
>PRK00022 lolB outer membrane lipoprotein LolB; Provisional Back     alignment and domain information
>TIGR02747 TraV type IV conjugative transfer system protein TraV; InterPro: IPR014118 This entry includes TraV, which is a component of conjugative type IV secretion system Back     alignment and domain information
>PRK09915 putative outer membrane efflux protein MdtP; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00