254780375

254780375

hypothetical protein CLIBASIA_01300

GeneID in NCBI database:8209360Locus tag:CLIBASIA_01300
Protein GI in NCBI database:254780375Protein Accession:YP_003064788.1
Gene range:-(273154, 273681)Protein Length:175aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcc
ccEEEEEEEccHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccc
MILLPIIYYYKKRDMLSQLLFLLFFFLQGfanqsygdptlvDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMdsdsaalqleqidpdisshilmrlsprqsslimskmnpksaTMITNVVANMLKfkklkrss
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMlkfkklkrss
MILLPIIYYYKKRDMLSQllfllffflQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS
MILLPIIYYYKKRDMLSQLLFLLFF**************************************************E***************************NKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMIT****************
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVxxxxxxxxxxxxxxxxxxxxxYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS
MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
254781213 556 head-to-tail joining protein, putative [Candidatus 0.016
>gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 556 Back     alignment
 Score = 30.4 bits (67), Expect = 0.016,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 73  KDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKN 106
           KDI+ R   L+N + E N W ++   F+  Y  N
Sbjct: 7   KDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNN 40

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
315121844170 hypothetical protein CKC_00470 [Candidatus Liberibacter 1 6e-72
227820861179 hypothetical protein NGR_c02800 [Sinorhizobium fredii N 1 1e-25
222084868179 hypothetical protein Arad_0885 [Agrobacterium radiobact 1 1e-25
255609650179 conserved hypothetical protein [Ricinus communis] Lengt 1 1e-25
15964418179 hypothetical protein SMc03033 [Sinorhizobium meliloti 1 1 3e-25
241203109180 exported flagella related protein [Rhizobium leguminosa 1 4e-25
150395488179 hypothetical protein Smed_0261 [Sinorhizobium medicae W 1 4e-25
116250485180 flagella related protein [Rhizobium leguminosarum bv. v 1 5e-25
12057224179 unknown [Sinorhizobium meliloti] Length = 179 1 5e-25
86356315171 hypothetical protein RHE_CH00664 [Rhizobium etli CFN 42 1 7e-25
>gi|315121844|ref|YP_004062333.1| hypothetical protein CKC_00470 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170 Back     alignment and organism information
 Score =  273 bits (698), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 134/170 (78%), Positives = 154/170 (90%)

Query: 1   MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERD 60
           MI L I+Y YKKR++LS+ LFLLF FLQGF +QS GD  L+D+EIQ+YCTNVID VRERD
Sbjct: 1   MISLFIVYCYKKRNILSKYLFLLFVFLQGFIHQSRGDSPLLDKEIQKYCTNVIDLVRERD 60

Query: 61  YLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAA 120
           YL QKKVLEDLQKDIE+R+I+LEN+K EY+LWF+KY+ FI SYNKNILDIYKKMD+DSAA
Sbjct: 61  YLLQKKVLEDLQKDIEKRIIVLENYKNEYDLWFKKYEQFISSYNKNILDIYKKMDADSAA 120

Query: 121 LQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKK 170
           LQLE+IDP ISSHILMRLSPRQSSLIMSKMNP+SAT+ITN+VANM KFKK
Sbjct: 121 LQLEKIDPSISSHILMRLSPRQSSLIMSKMNPQSATVITNIVANMFKFKK 170


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820861|ref|YP_002824831.1| hypothetical protein NGR_c02800 [Sinorhizobium fredii NGR234] Length = 179 Back     alignment and organism information
>gi|222084868|ref|YP_002543397.1| hypothetical protein Arad_0885 [Agrobacterium radiobacter K84] Length = 179 Back     alignment and organism information
>gi|255609650|ref|XP_002539076.1| conserved hypothetical protein [Ricinus communis] Length = 179 Back     alignment and organism information
>gi|15964418|ref|NP_384771.1| hypothetical protein SMc03033 [Sinorhizobium meliloti 1021] Length = 179 Back     alignment and organism information
>gi|241203109|ref|YP_002974205.1| exported flagella related protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 180 Back     alignment and organism information
>gi|150395488|ref|YP_001325955.1| hypothetical protein Smed_0261 [Sinorhizobium medicae WSM419] Length = 179 Back     alignment and organism information
>gi|116250485|ref|YP_766323.1| flagella related protein [Rhizobium leguminosarum bv. viciae 3841] Length = 180 Back     alignment and organism information
>gi|12057224|gb|AAB81416.2| unknown [Sinorhizobium meliloti] Length = 179 Back     alignment and organism information
>gi|86356315|ref|YP_468207.1| hypothetical protein RHE_CH00664 [Rhizobium etli CFN 42] Length = 171 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
COG3334192 COG3334, COG3334, Uncharacterized conserved protein [Fu 1e-20
>gnl|CDD|33143 COG3334, COG3334, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
COG3334192 Uncharacterized conserved protein [Function unknown] 99.96
COG3334192 Uncharacterized conserved protein [Function unknown] 98.59
pfam03448102 MgtE_N MgtE intracellular N domain. This domain is foun 98.09
pfam03448102 MgtE_N MgtE intracellular N domain. This domain is foun 97.64
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 97.57
TIGR00207 346 fliG flagellar motor switch protein FliG; InterPro: IPR 97.34
PRK07194 334 fliG flagellar motor switch protein G; Reviewed 97.3
PRK05686 337 fliG flagellar motor switch protein G; Validated 97.2
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 96.68
PRK07194 334 fliG flagellar motor switch protein G; Reviewed 95.5
PRK05686 337 fliG flagellar motor switch protein G; Validated 95.14
TIGR00207 346 fliG flagellar motor switch protein FliG; InterPro: IPR 93.76
COG1536 339 FliG Flagellar motor switch protein [Cell motility and 92.72
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. 91.14
PRK12705 485 hypothetical protein; Provisional 94.23
PRK11637 404 hypothetical protein; Provisional 93.75
pfam12072201 DUF3552 Domain of unknown function (DUF3552). This pres 92.99
>COG3334 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3334 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03448 MgtE_N MgtE intracellular N domain Back     alignment and domain information
>pfam03448 MgtE_N MgtE intracellular N domain Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>PRK07194 fliG flagellar motor switch protein G; Reviewed Back     alignment and domain information
>PRK05686 fliG flagellar motor switch protein G; Validated Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07194 fliG flagellar motor switch protein G; Reviewed Back     alignment and domain information
>PRK05686 fliG flagellar motor switch protein G; Validated Back     alignment and domain information
>TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>COG1536 FliG Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>pfam12072 DUF3552 Domain of unknown function (DUF3552) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
2oux_A 286 Crystal Structure Of The Soluble Part Of A Magnesiu 0.004
>gi|145580251|pdb|2OUX|A Chain A, Crystal Structure Of The Soluble Part Of A Magnesium Transporter Length = 286 Back     alignment and structure
 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 26/72 (36%)

Query: 91  LWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKM 150
                    I   N+N  D   +     AA  L +   D +  +L  L   Q +  +S +
Sbjct: 61  KELADXFDVIEEDNENXKDYLAEXRPSYAADXLAEXYTDNAVDLLNXLDKSQKAKYLSLL 120

Query: 151 NPKSATMITNVV 162
           + + A  I  ++
Sbjct: 121 SSEEAGEIKELL 132


Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
2oux_A 286 Magnesium transporter; 10001B, structural genomics, PSI 97.92
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal transpor 97.79
2yvy_A 278 MGTE, Mg2+ transporter MGTE; membrane protein, transpor 97.79
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal transpor 97.67
1lkv_X232 Flagellar motor switch protein FLIG; chemotaxis, flagel 97.48
3hjl_A 329 Flagellar motor switch protein FLIG; armadillo repeat m 97.39
2yvy_A 278 MGTE, Mg2+ transporter MGTE; membrane protein, transpor 97.34
1lkv_X 232 Flagellar motor switch protein FLIG; chemotaxis, flagel 97.24
2oux_A 286 Magnesium transporter; 10001B, structural genomics, PSI 96.97
3kxr_A 205 Magnesium transporter, putative; cystathionine beta-syn 96.93
3hjl_A 329 Flagellar motor switch protein FLIG; armadillo repeat m 95.25
3kxr_A 205 Magnesium transporter, putative; cystathionine beta-syn 91.33
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
Probab=97.92  E-value=3.2e-05  Score=51.03  Aligned_cols=57  Identities=21%  Similarity=0.230  Sum_probs=53.4

Q ss_pred             HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             999995199899999996379899999997299899999996299999999999995
Q gi|254780375|r  107 ILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA  163 (175)
Q Consensus       107 lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la  163 (175)
                      ..++.++|+|+.++.+++.|++|++++++..++++....||+.|+++.+..+..+|.
T Consensus        77 ~~~ll~~l~~~~~~~ll~~l~~dd~~dll~~l~~~~~~~iL~~L~~~~r~~i~~ll~  133 (286)
T 2oux_A           77 MKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLSSEEAGEIKELLH  133 (286)
T ss_dssp             TTHHHHHSCHHHHHHHHTTSCHHHHHHHHHHSCHHHHHHHHHTSCHHHHHHHHHHTT
T ss_pred             HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCC
T ss_conf             999999589999999998589567899998689999999997168999999999737



>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>1lkv_X Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>1lkv_X Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} SCOP: a.118.14.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural genomics, PSI-2; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural genomics, PSI-2; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
d2ouxa1130 Magnesium transporter MgtE {Enterococcus faecalis [TaxI 98.4
d2yvxa1125 Magnesium transporter MgtE {Thermus thermophilus [TaxId 97.59
d2ouxa1130 Magnesium transporter MgtE {Enterococcus faecalis [TaxI 97.42
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 97.33
d2yvxa1125 Magnesium transporter MgtE {Thermus thermophilus [TaxId 97.3
d1lkvx_ 213 FliG {Thermotoga maritima [TaxId: 2336]} 97.21
>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: MgtE N-terminal domain-like
family: MgtE N-terminal domain-like
domain: Magnesium transporter MgtE
species: Enterococcus faecalis [TaxId: 1351]
Probab=98.40  E-value=4.6e-07  Score=61.10  Aligned_cols=57  Identities=21%  Similarity=0.230  Sum_probs=54.1

Q ss_pred             HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             999995199899999996379899999997299899999996299999999999995
Q gi|254780375|r  107 ILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA  163 (175)
Q Consensus       107 lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la  163 (175)
                      ...++++|+|+.++.+++.|++|++++++..|+++.+..||+.|+|+.+..+..+|+
T Consensus        71 ~~~il~~l~~~~~a~il~~m~~DDaadll~~L~~~~~~~iL~~l~~~~r~~i~~lL~  127 (130)
T d2ouxa1          71 MKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLSSEEAGEIKELLH  127 (130)
T ss_dssp             TTHHHHHSCHHHHHHHHTTSCHHHHHHHHHHSCHHHHHHHHHTSCHHHHHHHHHHTT
T ss_pred             HHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHCC
T ss_conf             999986699999999998768687999999799999999998599999999999849



>d2yvxa1 a.118.26.1 (A:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yvxa1 a.118.26.1 (A:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target175 hypothetical protein CLIBASIA_01300 [Candidatus Liberib
2oux_A_59-14082 Magnesium transporter; 10001B, structural genomics 98.18
2yvy_A_56-13782 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.97
2zy9_A_1-158158 Mg2+ transporter MGTE; membrane protien, metal tra 97.87
2zy9_A_1-158158 Mg2+ transporter MGTE; membrane protien, metal tra 97.55
2yvy_A_56-13782 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.54
2oux_A_59-14082 Magnesium transporter; 10001B, structural genomics 97.44
1lkv_X_1-6565 Flagellar motor switch protein FLIG; chemotaxis, f 96.96
1lkv_X_1-6565 Flagellar motor switch protein FLIG; chemotaxis, f 94.85
>2oux_A (A:59-140) Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} Back     alignment and structure
Probab=98.18  E-value=7.3e-06  Score=56.02  Aligned_cols=56  Identities=20%  Similarity=0.195  Sum_probs=53.4

Q ss_pred             HHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             99995199899999996379899999997299899999996299999999999995
Q gi|254780375|r  108 LDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA  163 (175)
Q Consensus       108 v~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la  163 (175)
                      .+|+++|+++.++.+++.|+.|+++++|..|+++....||..|+++.+..+..+|+
T Consensus        20 ~~ii~~l~~~~~~~il~~l~~Dd~adll~~lp~~~~~~il~~l~~~~r~~i~~ll~   75 (82)
T 2oux_A           20 KDYLAEXRPSYAADXLAEXYTDNAVDLLNXLDKSQKAKYLSLLSSEEAGEIKELLH   75 (82)
T ss_dssp             THHHHHSCHHHHHHHHTTSCHHHHHHHHHHSCHHHHHHHHHTSCHHHHHHHHHHTT
T ss_pred             HHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999689999999998657046667788620888889987301457899999752



>2yvy_A (A:56-137) MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2zy9_A (A:1-158) Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2zy9_A (A:1-158) Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A Back     alignment and structure
>2yvy_A (A:56-137) MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A Back     alignment and structure
>2oux_A (A:59-140) Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} Back     alignment and structure
>1lkv_X (X:1-65) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure
>1lkv_X (X:1-65) Flagellar motor switch protein FLIG; chemotaxis, flagellar motion, structural protein; 2.80A {Thermotoga maritima} Back     alignment and structure