254780376

254780376

flagellar basal body P-ring protein

GeneID in NCBI database:8209361Locus tag:CLIBASIA_01305
Protein GI in NCBI database:254780376Protein Accession:YP_003064789.1
Gene range:-(273678, 274787)Protein Length:369aa
Gene description:flagellar basal body P-ring protein
COG prediction:[N] Flagellar basal-body P-ring protein
KEGG prediction:flgI; flagellar basal body P-ring protein; K02394 flagellar P-ring protein precursor FlgI
SEED prediction:Flagellar P-ring protein FlgI
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
cHHHHHHHHHHHHHHHccccccccccccEEEEcccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHccccccccccccccEEEEEEEEEcccccccccEEEEEEEEEcccccccccEEEEEEcccccccEEEEEEEEEEEEcEEccccccEEEEcccccEEcccccEEEEEcccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccccEEEcccEEEEEccccccHHHHHHHHHccccccccccEEEEEccccEEEEcccEEEEEEEEEEccEEEEEEcccccccccccccccEEEEcccccEEEEccccEEEEcccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEEc
cccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEEEccEEEEccccccccccccccHHHHHHHHHHcccEccccccccccEEEEEEEcccccccccccEEEEEEEEcccccHccccEEEEcccccccccEEEEEEccEEEEcccccccccEEEEcccccccccccEEEEEEcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHccccccEcccccEEEEEccccHHHHHHHHHHHccccccccccEEEEEcccEEEEEccEEEEEEEEEEcccEEEEEEcccccccccccccccEEEEccccEEEEEccccEEEEcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEEc
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSlqsgrdnqlIGYGLVVGlqgtgdslrsspftEQSMRSLLQNlgistpggrlgskNVAAVMVtanlppfaspgsridvsinslgdasslrGGILVMTSLLGADGNIYAVAQGSVVVSGLfvkgqsssfmegistggkivngaiverelpkkfkDSADLILQLrnpdfstaIRIADQInsyslnrfsrpiaeaydsrtvkvskptnidlTRLMSEVEMLtvetdtparviinertgtivigdnVRISKVVVSYGNltvqiteneqvvqpnafssngstvtqnntdlkvsdnkgsfslidapdlnslisgmnsiglktDGIISILQGIKAAGALQSEIIIQ
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANlppfaspgsRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADqinsyslnrfsrpiaeaydsrtvkvskptnidltrlmsEVEMltvetdtparviinertgtivigdnvrISKVVVSYGNLTVQITENEQVVQPNAfssngstvtqnnTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAgalqseiiiq
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
*IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGL***********FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVS***************STGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT*****************IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ
MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target369 flagellar basal body P-ring protein [Candidatus Liberib
315121845369 flagellar basal body P-ring protein [Candidatus Liberib 1 0.0
190890365373 flagellar basal body P-ring protein [Rhizobium etli CIA 1 1e-135
86356314373 flagellar basal body P-ring protein [Rhizobium etli CFN 1 1e-134
327193037522 flagellar basal body P-ring protein [Rhizobium etli CNP 1 1e-134
218672799370 flagellar basal body P-ring protein [Rhizobium etli GR5 1 1e-134
116250484373 flagellar basal body P-ring protein [Rhizobium legumino 1 1e-134
222084867372 flagellar basal-body P-ring protein [Agrobacterium radi 1 1e-134
241203108373 flagellar basal body P-ring protein [Rhizobium legumino 1 1e-134
209547930373 flagellar basal body P-ring protein [Rhizobium legumino 1 1e-133
15887896373 flagellar basal body P-ring protein [Agrobacterium tume 1 1e-133
>gi|315121845|ref|YP_004062334.1| flagellar basal body P-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 369 Back     alignment and organism information
 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/369 (87%), Positives = 344/369 (93%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIA  +FS I L+   AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIALFVFSCIILNSTLAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGIST GG+LGSKN+AAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTQGGKLGSKNIAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSL+GADGNIYAVAQGSVVVSG F+KG+ SS MEGI+TGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLVGADGNIYAVAQGSVVVSGFFIKGELSSIMEGIATGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KF+D+ DLILQLRNPDFST+IRIADQIN+YSL RF +PIAEA+DSRTVKVSKPTNIDLTR
Sbjct: 181 KFRDAIDLILQLRNPDFSTSIRIADQINTYSLGRFGKPIAEAHDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSE+EMLTVETDTPAR+IINERTGTIVIGDNVRISKVVVSYG+LTVQITEN QVVQPN 
Sbjct: 241 LMSEIEMLTVETDTPARIIINERTGTIVIGDNVRISKVVVSYGSLTVQITENRQVVQPNV 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            SS G T+ Q +TDL+  +NK  FSLIDAPDLNSLISGMNS+GLKTDGIISILQGIKAAG
Sbjct: 301 LSSGGKTLVQQSTDLQTFNNKSPFSLIDAPDLNSLISGMNSMGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890365|ref|YP_001976907.1| flagellar basal body P-ring protein [Rhizobium etli CIAT 652] Length = 373 Back     alignment and organism information
>gi|86356314|ref|YP_468206.1| flagellar basal body P-ring protein [Rhizobium etli CFN 42] Length = 373 Back     alignment and organism information
>gi|327193037|gb|EGE59949.1| flagellar basal body P-ring protein [Rhizobium etli CNPAF512] Length = 522 Back     alignment and organism information
>gi|218672799|ref|ZP_03522468.1| flagellar basal body P-ring protein [Rhizobium etli GR56] Length = 370 Back     alignment and organism information
>gi|116250484|ref|YP_766322.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv. viciae 3841] Length = 373 Back     alignment and organism information
>gi|222084867|ref|YP_002543396.1| flagellar basal-body P-ring protein [Agrobacterium radiobacter K84] Length = 372 Back     alignment and organism information
>gi|241203108|ref|YP_002974204.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 373 Back     alignment and organism information
>gi|209547930|ref|YP_002279847.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 373 Back     alignment and organism information
>gi|15887896|ref|NP_353577.1| flagellar basal body P-ring protein [Agrobacterium tumefaciens str. C58] Length = 373 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target369 flagellar basal body P-ring protein [Candidatus Liberib
PRK05303367 PRK05303, flgI, flagellar basal body P-ring protein; Pr 1e-135
PRK12789367 PRK12789, flgI, flagellar basal body P-ring protein; Re 1e-123
COG1706365 COG1706, FlgI, Flagellar basal-body P-ring protein [Cel 1e-110
PRK12706328 PRK12706, flgI, flagellar basal body P-ring protein; Pr 8e-14
pfam02119342 pfam02119, FlgI, Flagellar P-ring protein 1e-129
>gnl|CDD|180004 PRK05303, flgI, flagellar basal body P-ring protein; Provisional Back     alignment and domain information
>gnl|CDD|183746 PRK12789, flgI, flagellar basal body P-ring protein; Reviewed Back     alignment and domain information
>gnl|CDD|31892 COG1706, FlgI, Flagellar basal-body P-ring protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183694 PRK12706, flgI, flagellar basal body P-ring protein; Provisional Back     alignment and domain information
>gnl|CDD|145332 pfam02119, FlgI, Flagellar P-ring protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 369 flagellar basal body P-ring protein [Candidatus Liberib
PRK12789367 flgI flagellar basal body P-ring protein; Reviewed 100.0
PRK05303368 flgI flagellar basal body P-ring protein; Provisional 100.0
pfam02119342 FlgI Flagellar P-ring protein. 100.0
COG1706365 FlgI Flagellar basal-body P-ring protein [Cell motility 100.0
PRK12706328 flgI flagellar basal body P-ring protein; Provisional 100.0
>PRK12789 flgI flagellar basal body P-ring protein; Reviewed Back     alignment and domain information
>PRK05303 flgI flagellar basal body P-ring protein; Provisional Back     alignment and domain information
>pfam02119 FlgI Flagellar P-ring protein Back     alignment and domain information
>COG1706 FlgI Flagellar basal-body P-ring protein [Cell motility and secretion] Back     alignment and domain information
>PRK12706 flgI flagellar basal body P-ring protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00