254780377

254780377

flagellar basal body P-ring biosynthesis protein FlgA

GeneID in NCBI database:8209362Locus tag:CLIBASIA_01310
Protein GI in NCBI database:254780377Protein Accession:YP_003064790.1
Gene range:-(274784, 275242)Protein Length:152aa
Gene description:flagellar basal body P-ring biosynthesis protein FlgA
COG prediction:[N] [O] Flagellar basal body P-ring biosynthesis protein
KEGG prediction:flgA; flagellar basal body P-ring biosynthesis protein FlgA; K02386 flagella basal body P-ring formation protein FlgA
SEED prediction:Flagellar basal-body P-ring formation protein flgA
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
ccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccccccHHHEEEEEEEcccccccccccHHHHcccEEEEEcccccEEcHHHccccEEEccccEEEEEEEcccEEEEEEEEEccccccccEEEEEEcccccEEEEEEEcccEEEEEEc
cccccccHHHHHHHHHHHHHHHHccccEEEEccEcccccEEcHHHEEEEEcccccccccccccHHHHHHHHHHHHccccccccHHHccccEEEEcccEEEEEEEcccEEEEEEcEEccccccccEEEEEEccccEEEEEEEEcccEEEEEEc
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLkemqvtnsnirgnyaHSIKDVVGLVTRrvllpdhviplsvlhrpyvisrGAKVRIILTQGNMTISTAGIalsdasigdviavknidtgvmvsgsvvdtgtvrvvvk
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQvtnsnirgnyaHSIKDVVGLVTRRVLLPdhviplsvlhrpyvisRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDtgvmvsgsvvdtgtvrvvvk
MDCVRfllffslyvlsldslfASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIdtgvmvsgsvvdtgtvrvvvK
****RFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
*DCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK
MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
315121846149 flagellar basal body P-ring biosynthesis protein FlgA [ 1 4e-52
222084866166 flagellar basal-body rod protein [Agrobacterium radioba 1 5e-29
86356313160 flagellar basal body P-ring biosynthesis protein FlgA [ 1 3e-28
116250483160 flagellar basal body P-ring biosynthesis protein FlgA [ 1 1e-27
222147572159 flagellar protein FLGA precursor [Agrobacterium vitis S 1 1e-27
218672800163 flagellar basal body P-ring biosynthesis protein FlgA [ 1 2e-27
190890364160 flagellar basal-body rod protein [Rhizobium etli CIAT 6 1 2e-27
209547929160 flagellar basal body P-ring biosynthesis protein FlgA [ 1 5e-27
241203107160 flagellar basal body P-ring biosynthesis protein FlgA [ 1 1e-26
325291938162 flagellar basal body P-ring biosynthesis protein FlgA [ 1 4e-25
>gi|315121846|ref|YP_004062335.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 Back     alignment and organism information
 Score =  207 bits (527), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (81%)

Query: 4   VRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHS 63
           +R       YV  L+++ A+ +G AVVPSVVINAGEVL+E +LKE+ VTNSN+RGNYA  
Sbjct: 1   MRLFQVCLFYVFCLNAVLANGLGRAVVPSVVINAGEVLSELKLKELDVTNSNLRGNYARY 60

Query: 64  IKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIG 123
           IKDV GLVTRR LLPD +I LS LHRPYVISRG KVRIIL QGNMTIS AG+ALSDAS+G
Sbjct: 61  IKDVKGLVTRRTLLPDRIILLSALHRPYVISRGDKVRIILNQGNMTISAAGVALSDASVG 120

Query: 124 DVIAVKNIDTGVMVSGSVVDTGTVRVVVK 152
           D I+VKNIDTGV+VSGS +D GTVR+++K
Sbjct: 121 DAISVKNIDTGVIVSGSALDAGTVRIIIK 149


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084866|ref|YP_002543395.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84] Length = 166 Back     alignment and organism information
>gi|86356313|ref|YP_468205.1| flagellar basal body P-ring biosynthesis protein FlgA [Rhizobium etli CFN 42] Length = 160 Back     alignment and organism information
>gi|116250483|ref|YP_766321.1| flagellar basal body P-ring biosynthesis protein FlgA [Rhizobium leguminosarum bv. viciae 3841] Length = 160 Back     alignment and organism information
>gi|222147572|ref|YP_002548529.1| flagellar protein FLGA precursor [Agrobacterium vitis S4] Length = 159 Back     alignment and organism information
>gi|218672800|ref|ZP_03522469.1| flagellar basal body P-ring biosynthesis protein FlgA [Rhizobium etli GR56] Length = 163 Back     alignment and organism information
>gi|190890364|ref|YP_001976906.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 160 Back     alignment and organism information
>gi|209547929|ref|YP_002279846.1| flagellar basal body P-ring biosynthesis protein FlgA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 160 Back     alignment and organism information
>gi|241203107|ref|YP_002974203.1| flagellar basal body P-ring biosynthesis protein FlgA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 160 Back     alignment and organism information
>gi|325291938|ref|YP_004277802.1| flagellar basal body P-ring biosynthesis protein FlgA [Agrobacterium sp. H13-3] Length = 162 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
PRK06005160 PRK06005, flgA, flagellar basal body P-ring biosynthesi 3e-29
TIGR03170122 TIGR03170, flgA_cterm, flagella basal body P-ring forma 3e-23
PRK07018235 PRK07018, flgA, flagellar basal body P-ring biosynthesi 2e-17
PRK06804261 PRK06804, flgA, flagellar basal body P-ring biosynthesi 3e-12
PRK12786338 PRK12786, flgA, flagellar basal body P-ring biosynthesi 2e-10
PRK12618141 PRK12618, flgA, flagellar basal body P-ring biosynthesi 2e-08
PRK12617214 PRK12617, flgA, flagellar basal body P-ring biosynthesi 6e-05
COG1261220 COG1261, FlgA, Flagellar basal body P-ring biosynthesis 1e-22
>gnl|CDD|180347 PRK06005, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|163171 TIGR03170, flgA_cterm, flagella basal body P-ring formation protein FlgA Back     alignment and domain information
>gnl|CDD|180794 PRK07018, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|180704 PRK06804, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|183744 PRK12786, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|183626 PRK12618, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|183625 PRK12617, flgA, flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>gnl|CDD|31453 COG1261, FlgA, Flagellar basal body P-ring biosynthesis protein [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 152 flagellar basal body P-ring biosynthesis protein FlgA [
PRK07018236 flgA flagellar basal body P-ring biosynthesis protein F 100.0
PRK12617214 flgA flagellar basal body P-ring biosynthesis protein F 100.0
PRK06804272 flgA flagellar basal body P-ring biosynthesis protein F 100.0
PRK12786338 flgA flagellar basal body P-ring biosynthesis protein F 100.0
PRK12618138 flgA flagellar basal body P-ring biosynthesis protein F 100.0
COG1261220 FlgA Flagellar basal body P-ring biosynthesis protein [ 100.0
TIGR03170122 flgA_cterm flagella basal body P-ring formation protein 100.0
PRK06005161 flgA flagellar basal body P-ring biosynthesis protein F 100.0
PRK08515229 flgA flagellar basal body P-ring biosynthesis protein F 99.98
TIGR03177261 pilus_cpaB Flp pilus assembly protein CpaB. Members of 99.16
COG3745276 CpaB Flp pilus assembly protein CpaB [Intracellular tra 98.61
smart0085864 SAF This domain family includes a range of different pr 98.93
pfam0866663 SAF SAF domain. This domain family includes a range of 98.8
TIGR03586327 PseI pseudaminic acid synthase. 96.97
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesis, ou 96.95
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This family is 96.82
>PRK07018 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK12617 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK06804 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK12786 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK12618 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>COG1261 FlgA Flagellar basal body P-ring biosynthesis protein [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA Back     alignment and domain information
>PRK06005 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK08515 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>TIGR03177 pilus_cpaB Flp pilus assembly protein CpaB Back     alignment and domain information
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00858 SAF This domain family includes a range of different proteins Back     alignment and domain information
>pfam08666 SAF SAF domain Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
3frn_A278 Crystal Structure Of Flagellar Protein Flga From Th 5e-20
>gi|222447129|pdb|3FRN|A Chain A, Crystal Structure Of Flagellar Protein Flga From Thermotoga Maritima Msb8 Length = 278 Back     alignment and structure
 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 65/147 (44%), Gaps = 5/147 (3%)

Query: 9   FFSLYVL-----SLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHS 63
            FS+++         ++      + VV    IN G+V+ E  ++  +     I G     
Sbjct: 121 LFSVFLRFPDTYVTLNMLLRKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFD 180

Query: 64  IKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIG 123
           + +VVG ++RR L    V+   ++  P  + +G  V   +  G++ ++T    L +  +G
Sbjct: 181 VSEVVGKISRRYLKEGTVLTADMVKDPPDVVKGQVVPAYVDMGSIKVTTFVEVLENGYLG 240

Query: 124 DVIAVKNIDTGVMVSGSVVDTGTVRVV 150
           + +   N+++   V G V     +R++
Sbjct: 241 ETVRAMNVESRKYVFGRVERGPVLRIL 267


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
3frn_A278 Flagellar protein FLGA; structural genomics, periplasmi 1e-20
>3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Length = 278 Back     alignment and structure
 Score = 94.3 bits (234), Expect = 1e-20
 Identities = 28/122 (22%), Positives = 57/122 (46%)

Query: 29  VVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLH 88
           VV    IN G+V+ E  ++  +     I G     + +VVG ++RR L    V+   ++ 
Sbjct: 146 VVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFDVSEVVGKISRRYLKEGTVLTADMVK 205

Query: 89  RPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVR 148
            P  + +G  V   +  G++ ++T    L +  +G+ +   N+++   V G V     +R
Sbjct: 206 DPPDVVKGQVVPAYVDMGSIKVTTFVEVLENGYLGETVRAMNVESRKYVFGRVERGPVLR 265

Query: 149 VV 150
           ++
Sbjct: 266 IL 267


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
3frn_A278 Flagellar protein FLGA; structural genomics, periplasmi 100.0
1wvo_A79 Sialic acid synthase; antifreeze protein like domain, N 98.24
1ops_A64 Type III AFP, type III antifreeze protein; ICE crystal 98.15
1msi_A70 Type III antifreeze protein isoform HPLC 12; multigene 98.14
1c89_A134 RD3, antifreeze protein type III; thermal hysteresis pr 98.01
1ucs_A64 Antifreeze peptide RD1; small beta barrel, pretzel fold 97.84
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; NEUB 97.71
3g8r_A350 Probable spore coat polysaccharide biosynthesis protein 97.63
1vli_A385 Spore coat polysaccharide biosynthesis protein SPSE; 26 97.3
>3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=9.3e-34  Score=204.52  Aligned_cols=133  Identities=21%  Similarity=0.328  Sum_probs=128.3

Q ss_pred             CEEEEEEEEEEEEEEEECCCCCCCCHHHEEEEEEEHHHCCCCCCCCHHHHHCEEEECCCCCCCCCCHHHCCCCCCCCCCC
Q ss_conf             20778867888775200489966187437999968201784211586773030121022700001566402321003798
Q gi|254780377|r   18 DSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGA   97 (152)
Q Consensus        18 ~~~~~~~~~~vvVa~r~I~~G~~I~~~Dl~~~~~~~~~~~~~~~~~~~~~iG~~a~r~i~~G~~i~~~~l~~~~~V~~G~   97 (152)
                      ....+..+.+|+||+++|++|++|+++|+++++++.+.++.+++.+.++++|++++|+|.+|+||+.+||++|++|++||
T Consensus       135 ~~~~~r~~~~VvVa~r~I~~G~~It~~Dl~~~~~~~~~~~~~~~~~~~~viGk~a~r~i~~G~~i~~~~l~~~~~V~~G~  214 (278)
T 3frn_A          135 LNMLLRKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFDVSEVVGKISRRYLKEGTVLTADMVKDPPDVVKGQ  214 (278)
T ss_dssp             EEEEEECEEEEEEESSCBCTTCBCCTTTEEEEEEEGGGCSSCBCSCHHHHTTCEESSCBCTTCBCBGGGEECCCSBCTTC
T ss_pred             EEEEEEEEEEEEEECCCCCCCCEECHHHHCCEEEECCCCCCCCCCCHHHHCCEEECCCCCCCCCCCHHHCCCCCCCCCCC
T ss_conf             86578996579999444299999677770123753156897542797895892870356899946599836775147998


Q ss_pred             EEEEEEECCCEEEEEEEEECCCCCCCCEEEEEECCCCCEEEEEEEECCEEEEE
Q ss_conf             79999976978999999992448889779999889988899999729989999
Q gi|254780377|r   98 KVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVV  150 (152)
Q Consensus        98 ~V~i~~~~g~~~i~~~g~Al~~g~~Gd~IrV~N~~S~k~v~g~V~~~~~V~V~  150 (152)
                      .|.+.++.|+++|++.|+|+++|+.||.|+|+|++|||++.|+|.++|+|+|+
T Consensus       215 ~V~i~~~~g~i~i~~~g~Al~~G~~Gd~I~V~N~~S~k~i~g~V~~~g~V~Vi  267 (278)
T 3frn_A          215 VVPAYVDMGSIKVTTFVEVLENGYLGETVRAMNVESRKYVFGRVERGPVLRIL  267 (278)
T ss_dssp             EEEEEC-------CEEEEESSCBCTTCEEEEEC--CCCEEEEEEETTTEEEEC
T ss_pred             EEEEEEECCCEEEEEEEEECCCCCCCCEEEEEECCCCCEEEEEEECCCEEEEE
T ss_conf             89999605759999978998788989889999889999899999569969999



>1wvo_A Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ops_A Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>1msi_A Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Back     alignment and structure
>1ucs_A Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} SCOP: b.85.1.1 PDB: 9ame_A 1ame_A 1kde_A 1kdf_A 1gzi_A 1hg7_A 1b7i_A 2spg_A 1jab_A 1b7j_A 2msj_A 1ekl_A 4ame_A 7ame_A 2ame_A 1msj_A 1b7k_A 6ame_A 9msi_A 2jia_A ... Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
d1opsa_64 Type III antifreeze protein, AFP III {Ocean pout (Macro 98.07
d2zdra168 Capsule biosynthesis protein SiaC, C-terminal domain {N 97.97
d1vlia172 Spore coat polysaccharide biosynthesis protein SpsE, C- 97.73
d1ucsa_64 Type III antifreeze protein, AFP III {Antarctic eel pou 97.44
>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: AFP III-like domain
family: AFP III-like domain
domain: Type III antifreeze protein, AFP III
species: Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]
Probab=98.07  E-value=1.4e-06  Score=53.25  Aligned_cols=60  Identities=12%  Similarity=0.133  Sum_probs=50.4

Q ss_pred             EEEEEEECCCCCCCCHHHEEEEEEEHHHCCCCCCCCHHHHHCEEEECCCCCCCCCCHHHCCCC
Q ss_conf             877520048996618743799996820178421158677303012102270000156640232
Q gi|254780377|r   28 AVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRP   90 (152)
Q Consensus        28 vvVa~r~I~~G~~I~~~Dl~~~~~~~~~~~~~~~~~~~~~iG~~a~r~i~~G~~i~~~~l~~~   90 (152)
                      -+||+++|++|++|+++|+..++..-..++..   +.++++|+.++++|..|++|..+|++..
T Consensus         3 SiVA~~dI~~G~~lt~~~l~~Krp~p~GI~p~---~~~~iIGKk~kkdi~~d~~L~~d~ik~~   62 (64)
T d1opsa_           3 SVVATQLIPMNTALTPAMMEGKVTNPIGIPFA---EMSQLVGKQVNTPVAKGQTLMPNMVKTY   62 (64)
T ss_dssp             EEEESSCBCTTCBCCGGGEEEECCSSCCSBGG---GGGGTTTCBBSSCBCTTCBCCGGGBTTT
T ss_pred             CEEECCCCCCCCCCCHHHEEEEECCCCCCCHH---HHHHHCCHHHHCCCCCCCCCCHHHHHCC
T ss_conf             67867732898892578857871678870988---9999748575233069885189994122



>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ucsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Lycodichthys dearborni), RD1 isoform [TaxId: 8201]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 flagellar basal body P-ring biosynthesis protein F
3frn_A_208-27871 (A:208-278) Flagellar protein FLGA; structural gen 4e-11
3frn_A_1-207207 (A:1-207) Flagellar protein FLGA; structural genom 2e-04
>3frn_A (A:208-278) Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima}Length = 71 Back     alignment and structure
 Score = 61.7 bits (150), Expect = 4e-11
 Identities = 11/59 (18%), Positives = 28/59 (47%)

Query: 92  VISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVV 150
            + +G  V   +  G++ ++T    L +  +G+ +   N+++   V G V     +R++
Sbjct: 2   DVVKGQVVPAYVDMGSIKVTTFVEVLENGYLGETVRAMNVESRKYVFGRVERGPVLRIL 60


>3frn_A (A:1-207) Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima}Length = 207 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 flagellar basal body P-ring biosynthesis protein FlgA [
3frn_A_208-27871 Flagellar protein FLGA; structural genomics, perip 99.67
3frn_A_1-207207 Flagellar protein FLGA; structural genomics, perip 99.57
1wvo_A_79 Sialic acid synthase; antifreeze protein like doma 98.22
1ucs_A_64 Antifreeze peptide RD1; small beta barrel, pretzel 98.21
1msi_A_70 Type III antifreeze protein isoform HPLC 12; multi 98.21
1ops_A_64 Type III AFP, type III antifreeze protein; ICE cry 98.2
2wqp_A_277-34973 Polysialic acid capsule biosynthesis protein SIAC; 98.18
1c89_A_65-13470 RD3, antifreeze protein type III; thermal hysteres 98.14
1c89_A_1-6464 RD3, antifreeze protein type III; thermal hysteres 98.12
1vli_A_301-38585 Spore coat polysaccharide biosynthesis protein SPS 97.97
3g8r_A_280-35071 Probable spore coat polysaccharide biosynthesis pr 90.71
>3frn_A (A:208-278) Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
Probab=99.67  E-value=1.1e-16  Score=111.11  Aligned_cols=61  Identities=18%  Similarity=0.306  Sum_probs=59.4

Q ss_pred             CCCCCCCEEEEEEECCCEEEEEEEEECCCCCCCCEEEEEECCCCCEEEEEEEECCEEEEEE
Q ss_conf             1003798799999769789999999924488897799998899888999997299899997
Q gi|254780377|r   91 YVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVV  151 (152)
Q Consensus        91 ~~V~~G~~V~i~~~~g~~~i~~~g~Al~~g~~Gd~IrV~N~~S~k~v~g~V~~~~~V~V~~  151 (152)
                      |+|++||.|.+.++.++|+|++.|+||+||++||.|||+|++|+|++.|+|+++|+|+|..
T Consensus         1 PlV~rG~~V~v~~~~~g~~I~~~g~Al~~G~~Gd~IrVrN~~Sgkii~g~V~~~g~V~V~~   61 (71)
T 3frn_A            1 PDVVKGQVVPAYVDMGSIKVTTFVEVLENGYLGETVRAMNVESRKYVFGRVERGPVLRILE   61 (71)
T ss_dssp             CSBCTTCEEEEEC-------CEEEEESSCBCTTCEEEEEC--CCCEEEEEEETTTEEEECC
T ss_pred             CCCCCCCEEEEEEECCCEEEEEEEEECCCCCCCCEEEEEECCCCCEEEEEEECCCEEEEEE
T ss_conf             5147998899996057599999789987889898899998899998999995699699999



>3frn_A (A:1-207) Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
>1wvo_A (A:) Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ucs_A (A:) Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} Back     alignment and structure
>1msi_A (A:) Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} Back     alignment and structure
>1ops_A (A:) Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} Back     alignment and structure
>2wqp_A (A:277-349) Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1c89_A (A:65-134) RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} Back     alignment and structure
>1c89_A (A:1-64) RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} Back     alignment and structure
>1vli_A (A:301-385) Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} Back     alignment and structure
>3g8r_A (A:280-350) Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure