254780378

254780378

flagellar basal body rod protein FlgG

GeneID in NCBI database:8209363Locus tag:CLIBASIA_01315
Protein GI in NCBI database:254780378Protein Accession:YP_003064791.1
Gene range:-(275260, 276048)Protein Length:262aa
Gene description:flagellar basal body rod protein FlgG
COG prediction:[N] Flagellar basal body rod protein
KEGG prediction:flgG; flagellar basal body rod protein FlgG; K02392 flagellar basal-body rod protein FlgG
SEED prediction:Flagellar basal-body rod protein FlgG
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
ccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccccEEEccccEEEEEEccEEEEEEcccccEEEEEcccccccccccEEcccccEEccccccccccccEEEcccccEEEEcccccccccEEEEEEEccccHHHHEEccccEEEEcccccccccccccccccEEEEccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHccccHHHccHHHHHccHHccccccccccHHHHHHHHHHHHcccccccccccccEcccccEEccccEEEEEEEEccccccccccccccEEEEcccEEEEEcccccEEEEccccEEEcccccEEcccccEccccEEcccccEEEEEccccEEEEEEccccccEEEEEEEEEcccccccccccccccEEcccccccccccccccccccEEccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEkvagspsqsadkavvpegisigsgvqiSSVRNVYtqgevvhtgnnlDLALVgrgwfqvetpdktvmytragsfnidskgqlvtadgntlvpgivipeetreikvsrsgqilavtgknsdfqpVGQLLIANFINEaglrnigdnllartsvsgdpiisnpddigfAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVagspsqsadkAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGsfnidskgqlvtadgntlvpgivipeetreikvsrSGQILAvtgknsdfqpVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEiiannianinTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEgisigsgvqissvRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQA******************GISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAE************AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR
MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
254780525 421 flagellar hook protein FlgE [Candidatus Liberibact 1e-15
254780525421 flagellar hook protein FlgE [Candidatus Liberibact 8e-10
254780685243 flagellar basal body rod protein FlgF [Candidatus 2e-13
254780380134 flagellar basal body rod protein FlgC [Candidatus 0.009
>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Back     alignment
 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 16/132 (12%)

Query: 7   AAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEG 66
           A +GM AQ   +  +++NIAN++T GYKR    F+  ++        PS S         
Sbjct: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNSY------ 55

Query: 67  ISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSK 126
             +  G++IS+   +  QG ++HT +N DLA+ G+G+F V+  D     TRAG F+I+++
Sbjct: 56  --VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE 113

Query: 127 GQLVTADGNTLV 138
           G L    G  L+
Sbjct: 114 GFLENVAGGVLL 125

>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Back     alignment
 Score = 55.8 bits (133), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 117 RAGSFNIDSKG--QLVTAD--GNTLVPGIVIPEET----------REIKVSRSGQILAVT 162
           +A SFN ++ G  Q +T D    T + G  IP+++          ++  VS+ G +  + 
Sbjct: 262 KAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY 321

Query: 163 GKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEA 222
              +   P+ +L IA   +E  L+    N    T  SGD  I  P       +  G LE 
Sbjct: 322 DDGTRV-PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALET 380

Query: 223 SNVDAVKEISEMISAQRAYEMNSKVIE-AADEMSSLITKMR 262
           +NVD   E++E+I AQR Y +NSKV +  +D M  LI+  R
Sbjct: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421

>gi|254780685|ref|YP_003065098.1| flagellar basal body rod protein FlgF [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Back     alignment
 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 120/252 (47%), Gaps = 32/252 (12%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +F I  A   A +  L  +A+N++N +T G++  + +F++       V G+     D+ +
Sbjct: 4   SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSE-------VVGAIKNDIDQKI 56

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
                 + SG +  S + V   G  + TG  LD AL G  WF +E+P + ++ TR G F 
Sbjct: 57  S----FVASGKEYLS-KEV---GSFISTGTELDFALEGDAWFALESP-RGIILTRDGRFK 107

Query: 123 IDSKGQLVTADGNTLVPGIV-IPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +   G LV+A G   V  +  +P     I++ +  +I  V G+  +    G++     I 
Sbjct: 108 VTDDGSLVSASGKYPVLDMASVP-----IQIPQKDEIFNV-GEKGEISQKGKV-----IA 156

Query: 182 EAGLRNI--GDNLLARTSVSGDP-IISNP-DDIGFAHVKQGYLEASNVDAVKEISEMISA 237
             GL ++      + R +    P I   P +D+    VK+G+LE SN +++ E+ +MI  
Sbjct: 157 TMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHL 216

Query: 238 QRAYEMNSKVIE 249
            + +   + +I+
Sbjct: 217 TQKFNSITTLID 228

>gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] Length = 134 Back     alignment
 Score = 32.3 bits (72), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTG-------YKRARAEFADFLY 45
          IA +G++ Q   ++II+ NIAN  TTG       Y+R    F + ++
Sbjct: 10 IANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMH 56

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
315121847262 flagellar basal body rod protein FlgG [Candidatus Liber 1 1e-131
227820858262 flagellar basal body rod protein FlgG [Sinorhizobium fr 1 6e-93
15964415262 flagellar basal body rod protein FlgG [Sinorhizobium me 1 6e-93
2275161262 FlgG [Sinorhizobium meliloti] Length = 262 1 1e-92
163758015262 flagellar basal-body rod protein [Hoeflea phototrophica 1 9e-92
150395485262 flagellar basal body rod protein FlgG [Sinorhizobium me 1 2e-91
15887898262 flagellar basal body rod protein FlgG [Agrobacterium tu 1 3e-89
209547928262 flagellar basal body rod protein FlgG [Rhizobium legumi 1 1e-88
86356312262 flagellar basal body rod protein FlgG [Rhizobium etli C 1 2e-88
325291939262 flagellar basal body rod protein FlgG [Agrobacterium sp 1 4e-88
>gi|315121847|ref|YP_004062336.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/262 (90%), Positives = 254/262 (96%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKAF IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEK AGSPSQSAD+
Sbjct: 1   MKAFTIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKAAGSPSQSADQ 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +VVPEGI+IGSGVQISSVRNVYTQGE+VHTGN+LDLALVGRGWFQVETPDKTVMYTRAGS
Sbjct: 61  SVVPEGINIGSGVQISSVRNVYTQGELVHTGNSLDLALVGRGWFQVETPDKTVMYTRAGS 120

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FNIDSKGQLVT+DGNTL+PGI IPEE RE+ VSRSGQI+AVTGKNSDFQP+GQLLIANF+
Sbjct: 121 FNIDSKGQLVTSDGNTLLPGITIPEEARELTVSRSGQIMAVTGKNSDFQPLGQLLIANFV 180

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGLRNIGDNL+ RTSVSG+ IIS+PDD GFAH+KQGYLEASNVDAVKEISEMISAQRA
Sbjct: 181 NEAGLRNIGDNLVTRTSVSGEAIISSPDDAGFAHIKQGYLEASNVDAVKEISEMISAQRA 240

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+AADEMSSL++KMR
Sbjct: 241 YEMNSKVIQAADEMSSLVSKMR 262


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820858|ref|YP_002824828.1| flagellar basal body rod protein FlgG [Sinorhizobium fredii NGR234] Length = 262 Back     alignment and organism information
>gi|15964415|ref|NP_384768.1| flagellar basal body rod protein FlgG [Sinorhizobium meliloti 1021] Length = 262 Back     alignment and organism information
>gi|2275161|gb|AAB81413.1| FlgG [Sinorhizobium meliloti] Length = 262 Back     alignment and organism information
>gi|163758015|ref|ZP_02165103.1| flagellar basal-body rod protein [Hoeflea phototrophica DFL-43] Length = 262 Back     alignment and organism information
>gi|150395485|ref|YP_001325952.1| flagellar basal body rod protein FlgG [Sinorhizobium medicae WSM419] Length = 262 Back     alignment and organism information
>gi|15887898|ref|NP_353579.1| flagellar basal body rod protein FlgG [Agrobacterium tumefaciens str. C58] Length = 262 Back     alignment and organism information
>gi|209547928|ref|YP_002279845.1| flagellar basal body rod protein FlgG [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 262 Back     alignment and organism information
>gi|86356312|ref|YP_468204.1| flagellar basal body rod protein FlgG [Rhizobium etli CFN 42] Length = 262 Back     alignment and organism information
>gi|325291939|ref|YP_004277803.1| flagellar basal body rod protein FlgG [Agrobacterium sp. H13-3] Length = 262 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
PRK12691262 PRK12691, flgG, flagellar basal body rod protein FlgG; 1e-103
TIGR02488259 TIGR02488, flgG_G_neg, flagellar basal-body rod protein 3e-90
PRK12692262 PRK12692, flgG, flagellar basal body rod protein FlgG; 8e-88
PRK12693261 PRK12693, flgG, flagellar basal body rod protein FlgG; 8e-83
PRK12694260 PRK12694, flgG, flagellar basal body rod protein FlgG; 1e-72
PRK12816264 PRK12816, flgG, flagellar basal body rod protein FlgG; 2e-66
TIGR03506231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 3e-64
PRK12636263 PRK12636, flgG, flagellar basal body rod protein FlgG; 1e-46
PRK12817260 PRK12817, flgG, flagellar basal body rod protein FlgG; 7e-46
PRK12690238 PRK12690, flgF, flagellar basal body rod protein FlgF; 1e-34
PRK12689253 PRK12689, flgF, flagellar basal body rod protein FlgF; 6e-32
PRK12818256 PRK12818, flgG, flagellar basal body rod protein FlgG; 2e-30
PRK12640246 PRK12640, flgF, flagellar basal body rod protein FlgF; 2e-28
PRK12642241 PRK12642, flgF, flagellar basal body rod protein FlgF; 2e-24
COG4787251 COG4787, FlgF, Flagellar basal body rod protein [Cell m 3e-23
PRK12641252 PRK12641, flgF, flagellar basal body rod protein FlgF; 6e-16
PRK12819257 PRK12819, flgG, flagellar basal body rod protein FlgG; 6e-10
COG4786265 COG4786, FlgG, Flagellar basal body rod protein [Cell m 1e-72
PRK05682 407 PRK05682, flgE, flagellar hook protein FlgE; Validated 1e-30
PRK08425 731 PRK08425, flgE, flagellar hook protein FlgE; Validated 8e-22
TIGR02489 719 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, e 1e-19
PRK06803 402 PRK06803, flgE, flagellar hook protein FlgE; Validated 8e-15
PRK12637 473 PRK12637, flgE, flagellar hook protein FlgE; Provisiona 1e-10
PRK05841 603 PRK05841, flgE, flagellar hook protein FlgE; Validated 4e-09
PRK12643209 PRK12643, flgF, flagellar basal body rod protein FlgF; 1e-04
COG1749 423 COG1749, FlgE, Flagellar hook protein FlgE [Cell motili 2e-26
COG1749423 COG1749, FlgE, Flagellar hook protein FlgE [Cell motili 4e-19
PRK05682407 PRK05682, flgE, flagellar hook protein FlgE; Validated 1e-18
PRK12637473 PRK12637, flgE, flagellar hook protein FlgE; Provisiona 1e-13
TIGR0249089 TIGR02490, flgF, flagellar basal-body rod protein FlgF 4e-13
PRK05841603 PRK05841, flgE, flagellar hook protein FlgE; Validated 2e-12
PRK08425731 PRK08425, flgE, flagellar hook protein FlgE; Validated 3e-12
TIGR02489719 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, e 1e-11
PRK06803402 PRK06803, flgE, flagellar hook protein FlgE; Validated 2e-11
pfam0642939 pfam06429, DUF1078, Domain of unknown function (DUF1078 3e-08
PRK05681135 PRK05681, flgC, flagellar basal body rod protein FlgC; 4e-07
TIGR01395135 TIGR01395, FlgC, flagellar basal-body rod protein FlgC 1e-06
COG1558137 COG1558, FlgC, Flagellar basal body rod protein [Cell m 6e-06
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 3e-05
PRK12631138 PRK12631, flgC, flagellar basal body rod protein FlgC; 6e-04
TIGR02492322 TIGR02492, flgK_ends, flagellar hook-associated protein 5e-07
PRK07739 507 PRK07739, flgK, flagellar hook-associated protein FlgK; 1e-06
COG1815133 COG1815, FlgB, Flagellar basal body protein [Cell motil 3e-06
PRK05683 676 PRK05683, flgK, flagellar hook-associated protein FlgK; 2e-05
PRK07191 456 PRK07191, flgK, flagellar hook-associated protein FlgK; 8e-05
COG1558137 COG1558, FlgC, Flagellar basal body rod protein [Cell m 2e-04
COG1256 552 COG1256, FlgK, Flagellar hook-associated protein [Cell 2e-04
PRK08147 547 PRK08147, flgK, flagellar hook-associated protein FlgK; 0.002
PRK12715 649 PRK12715, flgK, flagellar hook-associated protein FlgK; 0.003
PRK08471 613 PRK08471, flgK, flagellar hook-associated protein FlgK; 0.003
PRK06945 651 PRK06945, flgK, flagellar hook-associated protein FlgK; 0.004
PRK05681135 PRK05681, flgC, flagellar basal body rod protein FlgC; 8e-07
pfam0046031 pfam00460, Flg_bb_rod, Flagella basal body rod protein 5e-06
TIGR01395135 TIGR01395, FlgC, flagellar basal-body rod protein FlgC 2e-04
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 5e-04
TIGR01396131 TIGR01396, FlgB, flagellar basal-body rod protein FlgB 0.001
PRK12782138 PRK12782, flgC, flagellar basal body rod protein FlgC; 0.002
PRK12623131 PRK12623, flgB, flagellar basal body rod protein FlgB; 0.002
PRK05680137 PRK05680, flgB, flagellar basal body rod protein FlgB; 0.002
>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria Back     alignment and domain information
>gnl|CDD|139158 PRK12692, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183687 PRK12693, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183766 PRK12816, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|183640 PRK12636, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183685 PRK12690, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183768 PRK12818, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183642 PRK12640, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183643 PRK12642, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|34398 COG4787, FlgF, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|105809 PRK12641, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183769 PRK12819, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon proteobacterial Back     alignment and domain information
>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional Back     alignment and domain information
>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|139117 PRK12643, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|31935 COG1749, FlgE, Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|31935 COG1749, FlgE, Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional Back     alignment and domain information
>gnl|CDD|162884 TIGR02490, flgF, flagellar basal-body rod protein FlgF Back     alignment and domain information
>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon proteobacterial Back     alignment and domain information
>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|148188 pfam06429, DUF1078, Domain of unknown function (DUF1078) Back     alignment and domain information
>gnl|CDD|180197 PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|130462 TIGR01395, FlgC, flagellar basal-body rod protein FlgC Back     alignment and domain information
>gnl|CDD|31746 COG1558, FlgC, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|183636 PRK12631, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|162886 TIGR02492, flgK_ends, flagellar hook-associated protein FlgK Back     alignment and domain information
>gnl|CDD|181099 PRK07739, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|32000 COG1815, FlgB, Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|168176 PRK05683, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|180871 PRK07191, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|31746 COG1558, FlgC, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|31448 COG1256, FlgK, Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|181252 PRK08147, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|183698 PRK12715, flgK, flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>gnl|CDD|181438 PRK08471, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|180769 PRK06945, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|180197 PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|109515 pfam00460, Flg_bb_rod, Flagella basal body rod protein Back     alignment and domain information
>gnl|CDD|130462 TIGR01395, FlgC, flagellar basal-body rod protein FlgC Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB Back     alignment and domain information
>gnl|CDD|139220 PRK12782, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|180196 PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 262 flagellar basal body rod protein FlgG [Candidatus Liber
TIGR02488263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 100.0
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 100.0
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK05682414 flgE flagellar hook protein FlgE; Validated 100.0
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 100.0
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
TIGR03506231 FlgEFG_subfam fagellar hook-basal body proteins. This m 100.0
PRK06803398 flgE flagellar hook protein FlgE; Validated 100.0
PRK12637473 flgE flagellar hook protein FlgE; Provisional 100.0
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK05841605 flgE flagellar hook protein FlgE; Validated 100.0
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 100.0
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 100.0
PRK08425 716 flgE flagellar hook protein FlgE; Validated 100.0
TIGR02489 877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 100.0
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.8
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.8
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 99.76
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 99.76
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 99.75
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 99.74
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 99.73
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 99.73
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 99.71
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 99.67
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 99.02
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 98.95
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 98.9
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 98.83
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 98.83
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 98.78
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 98.76
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.62
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 98.58
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 98.48
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 98.47
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 98.47
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 98.33
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 93.26
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 92.2
PRK07739 500 flgK flagellar hook-associated protein FlgK; Validated 99.77
PRK07191 456 flgK flagellar hook-associated protein FlgK; Validated 99.6
PRK06799 431 flgK flagellar hook-associated protein FlgK; Validated 99.56
PRK06665 628 flgK flagellar hook-associated protein FlgK; Validated 99.08
PRK12714 624 flgK flagellar hook-associated protein FlgK; Provisiona 98.9
PRK12715 649 flgK flagellar hook-associated protein FlgK; Provisiona 98.89
TIGR02492 495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.8
PRK08147 547 flgK flagellar hook-associated protein FlgK; Validated 98.75
PRK08871 626 flgK flagellar hook-associated protein FlgK; Validated 98.73
PRK08471 612 flgK flagellar hook-associated protein FlgK; Validated 98.69
COG1256 552 FlgK Flagellar hook-associated protein [Cell motility a 98.62
PRK06945 649 flgK flagellar hook-associated protein FlgK; Validated 98.58
PRK05683 676 flgK flagellar hook-associated protein FlgK; Validated 98.5
PRK07521 482 flgK flagellar hook-associated protein FlgK; Validated 99.52
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 99.14
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 99.14
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 99.01
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 98.98
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 98.93
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 98.92
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 98.91
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 98.88
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 98.88
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 98.87
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 98.87
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 98.85
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 98.74
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 98.71
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.65
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 96.66
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 93.95
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 92.83
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
3a69_A402 Atomic Model Of The Bacterial Flagellar Hook Based 6e-19
3a69_A 402 Atomic Model Of The Bacterial Flagellar Hook Based 3e-15
1wlg_A299 Crystal Structure Of Flge31, A Major Fragment Of Th 1e-04
>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
 Score = 98.8 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 1/163 (0%)

Query: 100 GRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQIL 159
           G       T +     T + SF    +      +          P +    +++  G ++
Sbjct: 241 GTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVV 300

Query: 160 AVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGY 219
                  + Q +GQ+++ANF N  GL + GDN+ A T  SG  ++       F  +  G 
Sbjct: 301 GNYSNEQE-QVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGA 359

Query: 220 LEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           LEASNVD  KE+  MI AQR Y+ N++ I+  D++ + +  +R
Sbjct: 360 LEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
>gi|56554379|pdb|1WLG|A Chain A, Crystal Structure Of Flge31, A Major Fragment Of The Hook Protein Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
3a69_A 402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 1e-25
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 3e-21
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 3e-14
1wlg_A 299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 1e-09
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Length = 402 Back     alignment and structure
 Score =  112 bits (279), Expect = 1e-25
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 21/217 (9%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
           F  A +G++A  TNL++I NNIAN  T G+K   A FAD                     
Sbjct: 2   FSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA------------------ 43

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
             G  +G GV+++ +   +T G   +TG  LD+A+   G+F++   + +V Y+R G F +
Sbjct: 44  --GSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKL 101

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           D    LV   G  L             + +    I       +        +  N  +  
Sbjct: 102 DENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTD 161

Query: 184 GLRNIGD-NLLARTSVSGDPIISNPDDIGFAHVKQGY 219
            + +    ++    S +    ++  D  G AH    Y
Sbjct: 162 PVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVY 198


>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Length = 402 Back     alignment and structure
>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Length = 299 Back     alignment and structure
>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 100.0
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 100.0
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=374.28  Aligned_cols=239  Identities=35%  Similarity=0.610  Sum_probs=213.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             48999999999999659997754217773400002229999987640256766555665456663114420211232233
Q gi|254780378|r    3 AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVY   82 (262)
Q Consensus         3 ~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gv~~~~~~~~~   82 (262)
                      |||||+|||.|+|++|+|++|||||+|||||||+++.|++++.                    +.++|.||++.++.++|
T Consensus         1 s~~~a~sGl~A~q~al~vts~NIANaNT~GYsRq~v~f~~~~~--------------------~~~~G~GV~v~~v~r~~   60 (402)
T 3a69_A            1 SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA--------------------GSKVGLGVKVAGITQDF   60 (402)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHC--------------------------------------------------------
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHC--------------------CCCCCCCEEEEEEEEEC
T ss_conf             9789999999999735788888987776420657020777646--------------------68776744776789841


Q ss_pred             CCCCCCCCCCEEEEEECCCCEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCC-----------------CCCC-
Q ss_conf             5787332652121232377526531489857787521223525883414667610443-----------------1013-
Q gi|254780378|r   83 TQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPG-----------------IVIP-  144 (262)
Q Consensus        83 ~qG~l~~Tg~~lD~Ai~G~Gff~V~~~~G~~~yTR~G~f~~d~~G~Lvt~~G~~vl~~-----------------~~~p-  144 (262)
                      .||.++.|++++|+||.|+|||.+..++|+.+|||.|+|.+|.+|+||+..|+.|++.                 +.++ 
T Consensus        61 ~qg~~~~t~~~~d~ai~~~g~f~~~~~~g~~~~tr~g~~~~~~~g~lvn~~g~~l~g~~~~~~~~~~~~~~~~~~~~i~~  140 (402)
T 3a69_A           61 TDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPN  140 (402)
T ss_dssp             ----------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECBTTTTBCCTTCCCEECCCCC
T ss_pred             CCCCEEECCCCCHHEECCCCEEEEECCCCCEEEEECCCCCCCCCCCEECCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             45645764760030142786178862798643641565342788878637896441231457775222567655521444


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780378|r  145 --------------------------------------------------------------------------------  144 (262)
Q Consensus       145 --------------------------------------------------------------------------------  144 (262)
                                                                                                      
T Consensus       141 ~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~d~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  220 (402)
T 3a69_A          141 TLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAAT  220 (402)
T ss_dssp             CCCCCBCCCEEEEEEEEETTCCCCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCC
T ss_pred             CCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCCEEEEECCCCCCCC
T ss_conf             45676553036763024655556653444557765513333379985899726666787763788523797036665554


Q ss_pred             -----------------------------------------------------------------CCCCCCCCCCCCEEE
Q ss_conf             -----------------------------------------------------------------565322101331255
Q gi|254780378|r  145 -----------------------------------------------------------------EETREIKVSRSGQIL  159 (262)
Q Consensus       145 -----------------------------------------------------------------~~~~~i~i~~dG~I~  159 (262)
                                                                                       .....+.|++||.|.
T Consensus       221 ~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~dG~~~~~~~~~~i~~dG~v~  300 (402)
T 3a69_A          221 APTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVV  300 (402)
T ss_dssp             CCCSCSEEEEECTTSBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEESCBCCCCEEEEEECTTCEEE
T ss_pred             CCCCCCEEEEECCCCCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             66555226874146521457720002345456555431000011200135653112102466555421234217895599


Q ss_pred             ECCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21588654322211000002662001006886433466665520002467762068607300102349999999999999
Q gi|254780378|r  160 AVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR  239 (262)
Q Consensus       160 ~~~~~~~~~~~i~~i~l~~f~n~~~L~~~g~~l~~~~~~~g~~~~~~~~~~~~~~v~qG~LE~SNVd~~~Emv~lI~~qR  239 (262)
                      +.+.. +....++++.++.|.||..|.+.|+++|..+..+|.+..+.+.....++|.||+||.||||+.+||++||..||
T Consensus       301 ~~~~~-~~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~~~~~~lE~S~V~ldeEmtnli~~Q~  379 (402)
T 3a69_A          301 GNYSN-EQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQR  379 (402)
T ss_dssp             EEETT-SCEEEEEEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCCC---------CHHHHHHHHHHHH
T ss_pred             EEECC-CCCCCCCCCCCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHH
T ss_conf             97356-54210011234566785773304796064355677730067887873148107545114799999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999987159
Q gi|254780378|r  240 AYEMNSKVIEAADEMSSLITKMR  262 (262)
Q Consensus       240 ~ye~n~k~i~t~Dem~~~~~~lr  262 (262)
                      +||+|+|+|++.|||+++++|||
T Consensus       380 aY~A~akvitt~demld~linlk  402 (402)
T 3a69_A          380 NYQSNAQTIKTQDQILNTLVNLR  402 (402)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99997526649999999997059



>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 262 flagellar basal body rod protein FlgG [Candidatus Liber
d1wlga_293 b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella 2e-12
d1wlga_ 293 b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella 7e-10
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Length = 293 Back     information, alignment and structure

class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
 Score = 66.9 bits (162), Expect = 2e-12
 Identities = 32/151 (21%), Positives = 54/151 (35%), Gaps = 5/151 (3%)

Query: 77  SVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNT 136
           S     T      T    +   +      V     T+    A +F++     +    G  
Sbjct: 144 SSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGAN 203

Query: 137 LVPGIVIPEETR----EIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNL 192
            +                +++  G ++     N   Q +GQ+++ANF N  GL + GDN+
Sbjct: 204 NIVATNQNGYKPGDLVSYQINNDGTVVG-NYSNEQEQVLGQIVLANFANNEGLASQGDNV 262

Query: 193 LARTSVSGDPIISNPDDIGFAHVKQGYLEAS 223
            A T  SG  ++       F  +  G LEAS
Sbjct: 263 WAATQASGVALLGTAGSGNFGKLTNGALEAS 293


>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Length = 293 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
d1wlga_293 Flagellar hook protein flgE {Salmonella typhimurium [Ta 99.96
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.96  E-value=4.2e-30  Score=199.68  Aligned_cols=129  Identities=33%  Similarity=0.567  Sum_probs=114.8

Q ss_pred             EEEEECCCCEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCC-----------------CCCCCC----------
Q ss_conf             21232377526531489857787521223525883414667610443-----------------101356----------
Q gi|254780378|r   94 LDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPG-----------------IVIPEE----------  146 (262)
Q Consensus        94 lD~Ai~G~Gff~V~~~~G~~~yTR~G~f~~d~~G~Lvt~~G~~vl~~-----------------~~~p~~----------  146 (262)
                      |||||+|+|||.|++++|+++|||+|+|++|++|+|||.+|++|+++                 +.+|..          
T Consensus         2 LDlAI~G~GFFvV~~~~g~~~YTRaG~F~~D~~G~Lvn~~G~~l~G~~~d~~~~~~~~~~~~~~i~i~~~~~~~~aTt~~   81 (293)
T d1wlga_           2 LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTA   81 (293)
T ss_dssp             EECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECBTTTTBCCTTCCCEECCCCCCCBCCBCCCEE
T ss_pred             CCEEECCCEEEEEECCCCCEEEECCCCEEECCCCCEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             64787487079987699988784488732989999883999989857636888631257765544344434577655146


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780378|r  147 --------------------------------------------------------------------------------  146 (262)
Q Consensus       147 --------------------------------------------------------------------------------  146 (262)
                                                                                                      
T Consensus        82 ~~~~NL~~~~~~~~~~~~~~~~~~t~~~~~s~~vyDs~G~~~~v~~~f~k~~~~~w~~~~~~~~~~~~~~~~~~~~~l~F  161 (293)
T d1wlga_          82 SMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKF  161 (293)
T ss_dssp             EEEEEEETTCCCCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCCCCCSCSEEEEE
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCCCCCCEEEEEC
T ss_conf             77416642123553222234787763301136764225864222056662046541378712566445466431356532


Q ss_pred             --------------------------------------------------------CCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             --------------------------------------------------------532210133125521588654322
Q gi|254780378|r  147 --------------------------------------------------------TREIKVSRSGQILAVTGKNSDFQP  170 (262)
Q Consensus       147 --------------------------------------------------------~~~i~i~~dG~I~~~~~~~~~~~~  170 (262)
                                                                              ...+.|++||.|.+.+ .|+..++
T Consensus       162 ~~~G~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~qdG~~~G~l~~~~i~~dG~i~~~y-sNG~~~~  240 (293)
T d1wlga_         162 NENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNY-SNEQEQV  240 (293)
T ss_dssp             CTTSBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEECCBCCBCEEEEEECTTCEEEEEE-TTSCEEE
T ss_pred             CCCCCCCCCCCEEECCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEEECCCEEEEEEE-CCCCEEE
T ss_conf             786322233310002344112432100025221000125740024432688431123210665875899997-6996789


Q ss_pred             CCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             21100000266200100688643346666552000246776206860730010
Q gi|254780378|r  171 VGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEAS  223 (262)
Q Consensus       171 i~~i~l~~f~n~~~L~~~g~~l~~~~~~~g~~~~~~~~~~~~~~v~qG~LE~S  223 (262)
                      ++||+|++|.||+.|+++|+++|+++.+||.+..+.|+..+.++|.+|+||.|
T Consensus       241 lgqiala~F~Np~gL~~~g~n~f~~t~~SG~~~~g~~g~~g~G~i~~g~LE~S  293 (293)
T d1wlga_         241 LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEAS  293 (293)
T ss_dssp             EEEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCSSCEEEEC
T ss_pred             EEEEEEEEECCHHHHHHCCCCEEECCCCCCCCEECCCCCCCCEEEECCCEECC
T ss_conf             88999997359687321259708760016885556899888223842613169



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 262 flagellar basal body rod protein FlgG [Candidatus
3a69_A_48-116_315-358113 (A:48-116,A:315-358) Flagellar HOOK protein FLGE; 2e-25
1wlg_A_1-46_245-28183 (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EA 2e-19
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}Length = 113 Back     alignment and structure
 Score =  110 bits (277), Expect = 2e-25
 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 36/149 (24%)

Query: 70  GSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQL 129
           G GV+++ +   +T G   +TG  LD+A+   G+F++   + +V Y+R G F +D    L
Sbjct: 1   GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNL 60

Query: 130 VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIG 189
           V   G  L                                     ++ANF N  GL + G
Sbjct: 61  VNMQGMQL------------------------------------TVLANFANNEGLASQG 84

Query: 190 DNLLARTSVSGDPIISNPDDIGFAHVKQG 218
           DN+ A T  SG  ++       F  +  G
Sbjct: 85  DNVWAATQASGVALLGTAGSGNFGKLTNG 113


>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium}Length = 83 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 flagellar basal body rod protein FlgG [Candidatus Liber
3a69_A_48-116_315-358113 Flagellar HOOK protein FLGE; the bacterial flagell 99.95
1wlg_A_1-46_245-28183 Flagellar HOOK protein FLGE; EAR-& motif, structur 99.85
1wlg_A_47-61_219-244_282-29959 Flagellar HOOK protein FLGE; EAR-& motif, structur 94.59
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=99.95  E-value=4.3e-29  Score=195.93  Aligned_cols=113  Identities=33%  Similarity=0.647  Sum_probs=107.5

Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44202112322335787332652121232377526531489857787521223525883414667610443101356532
Q gi|254780378|r   70 GSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETRE  149 (262)
Q Consensus        70 g~gv~~~~~~~~~~qG~l~~Tg~~lD~Ai~G~Gff~V~~~~G~~~yTR~G~f~~d~~G~Lvt~~G~~vl~~~~~p~~~~~  149 (262)
                      |.||++.+++++|+||+++.|++|||+||+|+|||.|++++|+++|||+|+|++|++|||||.+|++||           
T Consensus         1 G~Gv~~~~~~~~~~qG~l~~T~~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~ld~~G~Lvt~~G~~vl-----------   69 (113)
T 3a69_A            1 GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT-----------   69 (113)
T ss_dssp             -----------------------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEE-----------
T ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----------
T ss_conf             676477679996045545762645566622786036751578600013454220478871235674002-----------


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             210133125521588654322211000002662001006886433466665520002467762068607
Q gi|254780378|r  150 IKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQG  218 (262)
Q Consensus       150 i~i~~dG~I~~~~~~~~~~~~i~~i~l~~f~n~~~L~~~g~~l~~~~~~~g~~~~~~~~~~~~~~v~qG  218 (262)
                                               +|++|+||+.|+++|++.|.++..+|+|.++.|+..++++|..|
T Consensus        70 -------------------------al~~f~n~~gL~~~g~~~~~~t~~sG~~~~g~~g~~~~G~i~~G  113 (113)
T 3a69_A           70 -------------------------VLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNG  113 (113)
T ss_dssp             -------------------------CEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCCC-
T ss_pred             -------------------------CCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             -------------------------34566786774413784476133567730167887872547107



>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1wlg_A (A:47-61,A:219-244,A:282-299) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} Back     alignment and structure