254780379

254780379

flagellar hook-basal body protein FliE

GeneID in NCBI database:8209364Locus tag:CLIBASIA_01320
Protein GI in NCBI database:254780379Protein Accession:YP_003064792.1
Gene range:-(276077, 276403)Protein Length:108aa
Gene description:flagellar hook-basal body protein FliE
COG prediction:[N] [U] Flagellar hook-basal body protein
KEGG prediction:fliE; flagellar hook-basal body protein FliE; K02408 flagellar hook-basal body complex protein FliE
SEED prediction:Flagellar hook-basal body complex protein FliE
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:Flagellum in Campylobacter
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
ccHHHHcccHHHHccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cHHHHHHccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mmieqiqgtnsfishtdtigmrydftqnsneeggsspiSFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
mmieqiqgtnsfishtDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
**********************************************MA********************KTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQ*
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAV********
**I****GTNSFISHTDT**M****************ISFSALLQDMA*G*IGDME*A***SLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI
MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target108 flagellar hook-basal body protein FliE [Candidatus Libe
315121848107 flagellar hook-basal body protein FliE [Candidatus Libe 1 4e-30
222084864116 flagellar hook-basal body protein [Agrobacterium radiob 1 2e-12
190890362113 flagellar hook-basal body protein [Rhizobium etli CIAT 1 3e-11
86356311113 flagellar hook-basal body protein FliE [Rhizobium etli 1 5e-11
327193035113 flagellar hook-basal body protein FliE [Rhizobium etli 1 6e-11
241203105113 flagellar hook-basal body protein FliE [Rhizobium legum 1 6e-11
209547927113 flagellar hook-basal body protein FliE [Rhizobium legum 1 6e-11
218672514113 flagellar hook-basal body protein FliE [Rhizobium etli 1 7e-11
116250481101 flagellar hook-basal body protein FliE [Rhizobium legum 1 8e-11
218516083113 flagellar hook-basal body protein FliE [Rhizobium etli 1 8e-11
>gi|315121848|ref|YP_004062337.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 107 Back     alignment and organism information
 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/107 (62%), Positives = 83/107 (77%)

Query: 2   MIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENV 61
           MIEQIQ T  FI HT T+ M+ D  Q++ E   +S + FS+LLQDM + AIG ++KAE+ 
Sbjct: 1   MIEQIQRTEGFIPHTSTVEMQADSVQSAKEVSDASSVDFSSLLQDMVQEAIGKIKKAEDF 60

Query: 62  SLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI 108
           SL ALQGKTSMREA+D IMQAERTL +SIALRDKI+S+  E+SKMQI
Sbjct: 61  SLTALQGKTSMREAIDCIMQAERTLQVSIALRDKIVSSALEISKMQI 107


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084864|ref|YP_002543393.1| flagellar hook-basal body protein [Agrobacterium radiobacter K84] Length = 116 Back     alignment and organism information
>gi|190890362|ref|YP_001976904.1| flagellar hook-basal body protein [Rhizobium etli CIAT 652] Length = 113 Back     alignment and organism information
>gi|86356311|ref|YP_468203.1| flagellar hook-basal body protein FliE [Rhizobium etli CFN 42] Length = 113 Back     alignment and organism information
>gi|327193035|gb|EGE59947.1| flagellar hook-basal body protein FliE [Rhizobium etli CNPAF512] Length = 113 Back     alignment and organism information
>gi|241203105|ref|YP_002974201.1| flagellar hook-basal body protein FliE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 113 Back     alignment and organism information
>gi|209547927|ref|YP_002279844.1| flagellar hook-basal body protein FliE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 113 Back     alignment and organism information
>gi|218672514|ref|ZP_03522183.1| flagellar hook-basal body protein FliE [Rhizobium etli GR56] Length = 113 Back     alignment and organism information
>gi|116250481|ref|YP_766319.1| flagellar hook-basal body protein FliE [Rhizobium leguminosarum bv. viciae 3841] Length = 101 Back     alignment and organism information
>gi|218516083|ref|ZP_03512923.1| flagellar hook-basal body protein FliE [Rhizobium etli 8C-3] Length = 113 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target108 flagellar hook-basal body protein FliE [Candidatus Libe
PRK00790109 PRK00790, fliE, flagellar hook-basal body protein FliE; 1e-14
COG1677105 COG1677, FliE, Flagellar hook-basal body protein [Cell 5e-05
PRK00732102 PRK00732, fliE, flagellar hook-basal body protein FliE; 0.004
pfam0204997 pfam02049, FliE, Flagellar hook-basal body complex prot 2e-07
>gnl|CDD|179126 PRK00790, fliE, flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>gnl|CDD|31863 COG1677, FliE, Flagellar hook-basal body protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|179101 PRK00732, fliE, flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>gnl|CDD|145299 pfam02049, FliE, Flagellar hook-basal body complex protein FliE Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 108 flagellar hook-basal body protein FliE [Candidatus Libe
PRK00253105 fliE flagellar hook-basal body protein FliE; Reviewed 99.96
PRK00732103 fliE flagellar hook-basal body protein FliE; Reviewed 99.95
PRK03907100 fliE flagellar hook-basal body protein FliE; Reviewed 99.95
pfam0204997 FliE Flagellar hook-basal body complex protein FliE. 99.93
PRK0079099 fliE flagellar hook-basal body protein FliE; Reviewed 99.92
PRK1272897 fliE flagellar hook-basal body protein FliE; Provisiona 99.93
COG1677105 FliE Flagellar hook-basal body protein [Cell motility a 99.92
TIGR00205114 fliE flagellar hook-basal body complex protein (FliE); 99.87
PRK12729127 fliE flagellar hook-basal body protein FliE; Provisiona 99.79
PRK0169999 fliE flagellar hook-basal body protein FliE; Reviewed 99.64
PRK01482108 fliE flagellar hook-basal body protein FliE; Reviewed 99.38
>PRK00253 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>PRK00732 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>PRK03907 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>pfam02049 FliE Flagellar hook-basal body complex protein FliE Back     alignment and domain information
>PRK00790 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>PRK12728 fliE flagellar hook-basal body protein FliE; Provisional Back     alignment and domain information
>COG1677 FliE Flagellar hook-basal body protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00205 fliE flagellar hook-basal body complex protein (FliE); InterPro: IPR001624 Four genes from the major Bacillus subtilis chemotaxis locus have been shown to encode proteins that are similar to the Salmonella typhimurium FlgB, FlgC, FlgG and FliF proteins; a further gene product is similar to the Escherichia coli FliE protein Back     alignment and domain information
>PRK12729 fliE flagellar hook-basal body protein FliE; Provisional Back     alignment and domain information
>PRK01699 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information
>PRK01482 fliE flagellar hook-basal body protein FliE; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00