254780380

254780380

flagellar basal body rod protein FlgC

GeneID in NCBI database:8209365Locus tag:CLIBASIA_01325
Protein GI in NCBI database:254780380Protein Accession:YP_003064793.1
Gene range:-(276403, 276807)Protein Length:134aa
Gene description:flagellar basal body rod protein FlgC
COG prediction:[N] Flagellar basal body rod protein
KEGG prediction:flgC; flagellar basal body rod protein FlgC; K02388 flagellar basal-body rod protein FlgC
SEED prediction:Flagellar basal-body rod protein FlgC
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:Flagellum in Campylobacter
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccEEEEccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccHccccccEEEEEEEccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MDYLIASAHIANSGLAVQSARMQIISENIanarttgdtpgsdpyrrktisfeevmhgsggvrvkkigvdqstfveefdpghpvanasgivkypnvnvLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
MDYLIASAHIANSGLAVQSARMQIISENianarttgdtpgsdpYRRKTISFeevmhgsggvrvKKIGVDQSTFVEEFDPGHpvanasgivkypnVNVLVETADMRETNRLYMANLqtikqshdmmtttldllrd
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
****IASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYR************************************PVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLR*
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
**YLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD
MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLRD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
254780525 421 flagellar hook protein FlgE [Candidatus Liberibact 3e-04
254780381130 flagellar basal body rod protein FlgB [Candidatus 0.044
>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Back     alignment
 Score = 35.8 bits (81), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 19/124 (15%)

Query: 4   LIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVM-------H 56
           ++ S   A SG+  QS R+  +S+NIAN  T G       Y+R  I+F  ++       +
Sbjct: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVG-------YKRTAIAFSSLVFPSTSNSY 55

Query: 57  GSGGVRV--KKIGVDQSTFVEEFDPGHPVANASG--IVK-YPNVNVLVETADMRETNRLY 111
            SGG+ +  K +  +Q + +             G  IVK   NVN L    D    N  +
Sbjct: 56  VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGF 115

Query: 112 MANL 115
           + N+
Sbjct: 116 LENV 119

>gi|254780381|ref|YP_003064794.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter asiaticus str. psy62] Length = 130 Back     alignment
 Score = 28.5 bits (62), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 8/38 (21%)

Query: 19 SARMQIISENIANARTTGDTPGSDPYRRKTI-SFEEVM 55
          S R +I+SENIANA     TP    YR K I SFE ++
Sbjct: 18 SERQKIVSENIANA----STPN---YRAKDISSFETIL 48

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
315121849134 flagellar basal body rod protein FlgC [Candidatus Liber 1 3e-62
190890361138 flagellar basal-body rod protein [Rhizobium etli CIAT 6 1 3e-43
327193034138 flagellar basal-body rod protein [Rhizobium etli CNPAF5 1 8e-43
116250480138 flagellar basal body rod protein FlgC [Rhizobium legumi 1 9e-43
86356310138 flagellar basal body rod protein FlgC [Rhizobium etli C 1 1e-42
209547926138 flagellar basal body rod protein FlgC [Rhizobium legumi 1 2e-42
218672513138 flagellar basal body rod protein FlgC [Rhizobium etli G 1 2e-42
241203104138 flagellar basal body rod protein FlgC [Rhizobium legumi 1 2e-42
15887900139 flagellar basal body rod protein FlgC [Agrobacterium tu 1 3e-42
325291941139 flagellar basal body rod protein FlgC [Agrobacterium sp 1 8e-42
>gi|315121849|ref|YP_004062338.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 134 Back     alignment and organism information
 Score =  241 bits (614), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 122/134 (91%)

Query: 1   MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGG 60
           MDYL+AS+ IANSGL VQS+RM +ISENIANARTTG+T GSDPYRRKTISFEEVMH  GG
Sbjct: 1   MDYLVASSQIANSGLTVQSSRMHVISENIANARTTGNTAGSDPYRRKTISFEEVMHEGGG 60

Query: 61  VRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQ 120
           VRVKK+ VD+S FVEEFDP HPVANASGIVKYPNVNVLVETADMRETNRLYMANLQ IKQ
Sbjct: 61  VRVKKVSVDKSPFVEEFDPSHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQIIKQ 120

Query: 121 SHDMMTTTLDLLRD 134
           S DM+ TTLDLLRD
Sbjct: 121 SRDMIATTLDLLRD 134


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890361|ref|YP_001976903.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 138 Back     alignment and organism information
>gi|327193034|gb|EGE59946.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512] Length = 138 Back     alignment and organism information
>gi|116250480|ref|YP_766318.1| flagellar basal body rod protein FlgC [Rhizobium leguminosarum bv. viciae 3841] Length = 138 Back     alignment and organism information
>gi|86356310|ref|YP_468202.1| flagellar basal body rod protein FlgC [Rhizobium etli CFN 42] Length = 138 Back     alignment and organism information
>gi|209547926|ref|YP_002279843.1| flagellar basal body rod protein FlgC [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 138 Back     alignment and organism information
>gi|218672513|ref|ZP_03522182.1| flagellar basal body rod protein FlgC [Rhizobium etli GR56] Length = 138 Back     alignment and organism information
>gi|241203104|ref|YP_002974200.1| flagellar basal body rod protein FlgC [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 138 Back     alignment and organism information
>gi|15887900|ref|NP_353581.1| flagellar basal body rod protein FlgC [Agrobacterium tumefaciens str. C58] Length = 139 Back     alignment and organism information
>gi|325291941|ref|YP_004277805.1| flagellar basal body rod protein FlgC [Agrobacterium sp. H13-3] Length = 139 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
PRK12782138 PRK12782, flgC, flagellar basal body rod protein FlgC; 7e-48
PRK05681135 PRK05681, flgC, flagellar basal body rod protein FlgC; 6e-42
TIGR01395135 TIGR01395, FlgC, flagellar basal-body rod protein FlgC 4e-31
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 1e-25
PRK12630143 PRK12630, flgC, flagellar basal body rod protein FlgC; 6e-21
PRK12631138 PRK12631, flgC, flagellar basal body rod protein FlgC; 4e-14
PRK06802141 PRK06802, flgC, flagellar basal body rod protein FlgC; 1e-10
PRK12629135 PRK12629, flgC, flagellar basal body rod protein FlgC; 3e-09
COG1815133 COG1815, FlgB, Flagellar basal body protein [Cell motil 6e-07
PRK12628140 PRK12628, flgC, flagellar basal body rod protein FlgC; 1e-06
PRK05680137 PRK05680, flgB, flagellar basal body rod protein FlgB; 2e-05
COG1558137 COG1558, FlgC, Flagellar basal body rod protein [Cell m 5e-34
TIGR03506 231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 3e-06
PRK05682 407 PRK05682, flgE, flagellar hook protein FlgE; Validated 1e-05
PRK12691 262 PRK12691, flgG, flagellar basal body rod protein FlgG; 2e-05
TIGR02488 259 TIGR02488, flgG_G_neg, flagellar basal-body rod protein 5e-05
COG1749 423 COG1749, FlgE, Flagellar hook protein FlgE [Cell motili 2e-04
COG4786 265 COG4786, FlgG, Flagellar basal body rod protein [Cell m 5e-04
TIGR01396131 TIGR01396, FlgB, flagellar basal-body rod protein FlgB 7e-04
PRK07521 483 PRK07521, flgK, flagellar hook-associated protein FlgK; 0.001
PRK12694 260 PRK12694, flgG, flagellar basal body rod protein FlgG; 0.002
pfam0642939 pfam06429, DUF1078, Domain of unknown function (DUF1078 0.003
>gnl|CDD|139220 PRK12782, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|180197 PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|130462 TIGR01395, FlgC, flagellar basal-body rod protein FlgC Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|183635 PRK12630, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|183636 PRK12631, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|180702 PRK06802, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|183634 PRK12629, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|32000 COG1815, FlgB, Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|79089 PRK12628, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|180196 PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|31746 COG1558, FlgC, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria Back     alignment and domain information
>gnl|CDD|31935 COG1749, FlgE, Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB Back     alignment and domain information
>gnl|CDD|181014 PRK07521, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|148188 pfam06429, DUF1078, Domain of unknown function (DUF1078) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 134 flagellar basal body rod protein FlgC [Candidatus Liber
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 100.0
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 100.0
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 100.0
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 100.0
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 100.0
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 100.0
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 100.0
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 100.0
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 100.0
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 100.0
TIGR02488263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 99.97
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 99.64
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 99.6
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 99.59
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 99.56
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 99.52
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 99.52
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 99.49
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 99.49
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 99.47
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 99.43
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 99.43
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 99.4
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 99.39
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 99.38
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 99.36
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 99.25
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 96.42
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 99.94
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 99.93
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 99.92
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 99.92
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 99.91
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 99.91
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 99.91
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 99.91
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 99.91
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 99.91
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 99.9
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 99.9
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 99.9
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 99.89
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 99.89
PRK05682414 flgE flagellar hook protein FlgE; Validated 99.84
PRK06803398 flgE flagellar hook protein FlgE; Validated 99.81
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 99.7
PRK08425716 flgE flagellar hook protein FlgE; Validated 99.63
PRK05841605 flgE flagellar hook protein FlgE; Validated 99.58
PRK12637473 flgE flagellar hook protein FlgE; Provisional 99.53
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 99.5
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 99.17
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 99.15
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 99.14
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 99.09
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 99.02
TIGR02489877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 98.98
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 98.88
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 98.87
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 98.84
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 98.84
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.83
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 98.83
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 98.77
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 98.72
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 98.72
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 98.63
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 98.61
PRK12804307 flagellin; Provisional 94.03
PRK12802282 flagellin; Provisional 92.7
COG1344360 FlgL Flagellin and related hook-associated proteins [Ce 92.61
PRK12807287 flagellin; Provisional 91.69
PRK08869377 flagellin; Reviewed 91.34
PRK12805287 flagellin; Provisional 90.86
PRK12803335 flagellin; Provisional 90.64
PRK06819371 flagellin; Validated 90.28
PRK13589573 flagellin; Provisional 90.1
TIGR03506 231 FlgEFG_subfam fagellar hook-basal body proteins. This m 99.72
PRK07739 500 flgK flagellar hook-associated protein FlgK; Validated 98.95
PRK07521 482 flgK flagellar hook-associated protein FlgK; Validated 98.94
PRK08471 612 flgK flagellar hook-associated protein FlgK; Validated 98.83
PRK05841 605 flgE flagellar hook protein FlgE; Validated 98.82
PRK06799 431 flgK flagellar hook-associated protein FlgK; Validated 98.81
PRK08425 716 flgE flagellar hook protein FlgE; Validated 98.8
COG1749 423 FlgE Flagellar hook protein FlgE [Cell motility and sec 98.74
PRK07191 456 flgK flagellar hook-associated protein FlgK; Validated 98.74
PRK08147 547 flgK flagellar hook-associated protein FlgK; Validated 98.73
PRK12714 624 flgK flagellar hook-associated protein FlgK; Provisiona 98.72
PRK08871 626 flgK flagellar hook-associated protein FlgK; Validated 98.7
PRK06945 649 flgK flagellar hook-associated protein FlgK; Validated 98.68
PRK12637 473 flgE flagellar hook protein FlgE; Provisional 98.65
PRK12715 649 flgK flagellar hook-associated protein FlgK; Provisiona 98.65
PRK06665 628 flgK flagellar hook-associated protein FlgK; Validated 98.63
COG1256 552 FlgK Flagellar hook-associated protein [Cell motility a 98.61
PRK05683 676 flgK flagellar hook-associated protein FlgK; Validated 98.57
TIGR02492 495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.56
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 98.51
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.27
TIGR02489 877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 97.73
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12804 flagellin; Provisional Back     alignment and domain information
>PRK12802 flagellin; Provisional Back     alignment and domain information
>COG1344 FlgL Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>PRK12807 flagellin; Provisional Back     alignment and domain information
>PRK08869 flagellin; Reviewed Back     alignment and domain information
>PRK12805 flagellin; Provisional Back     alignment and domain information
>PRK12803 flagellin; Provisional Back     alignment and domain information
>PRK06819 flagellin; Validated Back     alignment and domain information
>PRK13589 flagellin; Provisional Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
3a69_A402 Atomic Model Of The Bacterial Flagellar Hook Based 1e-04
>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
 Score = 49.9 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 81  HPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDL 131
           +     +G ++  NV++  E  +M    R Y +N QTIK    ++ T ++L
Sbjct: 351 NFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNL 401


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
3a69_A 402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 1e-06
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Length = 402 Back     alignment and structure
 Score = 47.7 bits (112), Expect = 1e-06
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 10/63 (15%)

Query: 7  SAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGS---GGVRV 63
          S   A SGL   +  + +I  NIAN+ T G       ++  T SF ++  GS    GV+V
Sbjct: 1  SFSQAVSGLNAAATNLDVIGNNIANSATYG-------FKSGTASFADMFAGSKVGLGVKV 53

Query: 64 KKI 66
            I
Sbjct: 54 AGI 56


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 99.83
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 93.46
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=99.83  E-value=1.2e-20  Score=124.99  Aligned_cols=47  Identities=30%  Similarity=0.432  Sum_probs=44.0

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02333305610999999999999999999999999999999999964
Q gi|254780380|r   86 ASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLL  132 (134)
Q Consensus        86 ~~G~v~~snVd~~~Em~~m~~a~r~yean~~~~~~~~~m~~~~l~i~  132 (134)
                      .+|++|.||||+.+||++||..||+|+||.|+|.+.|+|++++|+|+
T Consensus       356 ~~~~lE~S~V~ldeEmtnli~~Q~aY~A~akvitt~demld~linlk  402 (402)
T 3a69_A          356 TNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR  402 (402)
T ss_dssp             CC---------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             EECCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             10754511479999999999999999997526649999999997059



>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target134 flagellar basal body rod protein FlgC [Candidatus Liber
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 93.37
1ory_B_55 Flagellin; flagellar chaperone, cytosolic export c 90.3
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
Probab=93.37  E-value=0.13  Score=27.36  Aligned_cols=42  Identities=21%  Similarity=0.303  Sum_probs=39.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             056109999999999999999999999999999999999646
Q gi|254780380|r   92 YPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLR  133 (134)
Q Consensus        92 ~snVd~~~Em~~m~~a~r~yean~~~~~~~~~m~~~~l~i~r  133 (134)
                      ..++|.+.||+++...+-..++...++..+.++-+..|.|+|
T Consensus        39 sADaD~A~E~~~~tk~qIL~Qa~~amLaQAN~~pq~vl~LLq   80 (80)
T 1ucu_A           39 SADSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLSLLR   80 (80)
T ss_dssp             TSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             CCHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             821319999999999999999999999997416789998409



>1ory_B (B:) Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Back     alignment and structure