254780386

254780386

Type I secretion membrane fusion protein, HlyD

GeneID in NCBI database:8209371Locus tag:CLIBASIA_01355
Protein GI in NCBI database:254780386Protein Accession:YP_003064799.1
Gene range:+(284258, 285580)Protein Length:440aa
Gene description:Type I secretion membrane fusion protein, HlyD
COG prediction:[M] Membrane-fusion protein
KEGG prediction:type I secretion membrane fusion protein, HlyD; K02022
SEED prediction:Alkaline protease secretion protein AprE
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccEEEEEcccccEEEEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccccEEEEEEEcccccccccccEEEEEEEcccEEEEEEEEcHHHHHHcccccEEEEEEEccccccccEEEEEEEEEEccccccccccccccEEEEEEEEccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHcc
cccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEcccEEEEEcccccEEEEEEEEcccEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEEEEccccEEcccccEEEEEcccccEEEEEEEcHcHHHHccccccEEEEEEEccccccccEEEEEEEEcccccccccccccccEEEEEEEEcHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHcc
mhhfmwknlkrnhpaslKRMTLLSIIGIIGLITWSILLPIEisvsssgeilnednvveikspfsGIIKKFQVengsqilqgtplltfediettdlidLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKnavsqndlnqqeRIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREqktilspiagtivynqsfsssnyaqqsqplmkivphskltyirakvtpkqiqhvkkgytatvrfphyaDIREKKFKAIIEKIDPiisqqdnnlqtQEYYEVILKITdlafsdnnielrngfpaevlFTAKNTTLAQEIIhpitdnwpkifer
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRChidteksaldflNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKnavsqndlnqqERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAkvtpkqiqhvkkgytatvrfphyaDIREKKFKAIIEKIdpiisqqdnnlQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTlaqeiihpitdnwpkifer
MHHFMWKNLKRNHPASLKRMtllsiigiiglitwsillPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
*************PASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESR****LDFL*KYHSTCS*V**********************************************LTMMKNLFEKNAVSQNDLNQQ*******************************************************************REQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKI**********ELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENxxxxxxxxxxxxxxxxxxxxxFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
315122201441 Type I secretion membrane fusion protein, HlyD [Candida 1 1e-174
307544060449 mandelate racemase [Halomonas elongata DSM 2581] Length 1 2e-17
152991144428 type I secretion system membrane fusion protein [Nitrat 1 2e-16
87198270446 Type I secretion membrane fusion protein, HlyD [Novosph 1 3e-15
300113968455 HlyD family type I secretion membrane fusion protein [N 1 1e-14
326388175449 Type I secretion membrane fusion protein, HlyD [Novosph 1 5e-14
104783706446 heme acquisition transporter, membrane fusion protein H 1 9e-14
330445560439 type I secretion membrane fusion, HlyD family protein [ 1 1e-13
190890292481 protein secretion protein, HlyD family [Rhizobium etli 1 7e-13
327191612481 putative protein secretion protein, HlyD family [Rhizob 1 8e-13
>gi|315122201|ref|YP_004062690.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 441 Back     alignment and organism information
 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 306/441 (69%), Positives = 363/441 (82%), Gaps = 1/441 (0%)

Query: 1   MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIK 60
           M++  WKN K++H  +L +  +LS IGI+GLI WSILLPIEI VSS GEIL ++++VEIK
Sbjct: 1   MYNIFWKNFKKHHLTTLAKTIILSTIGIVGLIIWSILLPIEIRVSSLGEILYDNDIVEIK 60

Query: 61  SPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFL 120
           SPFSGII KFQV NG+Q+LQG PLLTFED ET DL++LKK SI +L+C IDT  SAL+FL
Sbjct: 61  SPFSGIINKFQVNNGAQVLQGDPLLTFEDTETNDLLNLKKSSITDLKCRIDTANSALNFL 120

Query: 121 NNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLD 180
           N+KYDV+++AF+ R+EQLLDFL  Y  TCSKVFNY IS +YRSLK+KLTR  ++Y N LD
Sbjct: 121 NSKYDVIKRAFDIRDEQLLDFLRNYPPTCSKVFNYEISKLYRSLKLKLTRTHNLYSNYLD 180

Query: 181 LENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNM 240
           LE+K SL   LL SH+KDLT+ KNLF+ N VS+N+LNQQER+V+KS LEL  +++ QK M
Sbjct: 181 LEDKISLSNMLLLSHKKDLTITKNLFKDNVVSKNELNQQERVVHKSALELTTDLNAQKAM 240

Query: 241 LRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTI 300
           LRHINELYDEAN+EFANYLK+ISRDL+ NQRT  DE+SK TILEK   Q TILSPI GTI
Sbjct: 241 LRHINELYDEANVEFANYLKDISRDLDHNQRTLIDEISKATILEKKISQHTILSPIMGTI 300

Query: 301 VYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIRE 360
           VYNQSFSSSNY Q+SQ LMKIVP   LT+IRAKV P+QIQ VK G  ATVRFPHY DIRE
Sbjct: 301 VYNQSFSSSNYIQESQLLMKIVPRCDLTHIRAKVAPQQIQSVKNGQIATVRFPHYPDIRE 360

Query: 361 KKFKAIIEKIDPIISQQDNN-LQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKN 419
           KKFKAIIE I+PIISQ++N+  QTQ YYEVILKI D A+ DN IELRNG+ AE+LFTA+ 
Sbjct: 361 KKFKAIIETINPIISQRNNDSSQTQNYYEVILKIIDPAYFDNKIELRNGYLAEILFTAEY 420

Query: 420 TTLAQEIIHPITDNWPKIFER 440
           TTLA+EII PIT+NWPKIFER
Sbjct: 421 TTLAKEIIRPITNNWPKIFER 441


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307544060|ref|YP_003896539.1| mandelate racemase [Halomonas elongata DSM 2581] Length = 449 Back     alignment and organism information
>gi|152991144|ref|YP_001356866.1| type I secretion system membrane fusion protein [Nitratiruptor sp. SB155-2] Length = 428 Back     alignment and organism information
>gi|87198270|ref|YP_495527.1| Type I secretion membrane fusion protein, HlyD [Novosphingobium aromaticivorans DSM 12444] Length = 446 Back     alignment and organism information
>gi|300113968|ref|YP_003760543.1| HlyD family type I secretion membrane fusion protein [Nitrosococcus watsonii C-113] Length = 455 Back     alignment and organism information
>gi|326388175|ref|ZP_08209778.1| Type I secretion membrane fusion protein, HlyD [Novosphingobium nitrogenifigens DSM 19370] Length = 449 Back     alignment and organism information
>gi|104783706|ref|YP_610204.1| heme acquisition transporter, membrane fusion protein HasE [Pseudomonas entomophila L48] Length = 446 Back     alignment and organism information
>gi|330445560|ref|ZP_08309212.1| type I secretion membrane fusion, HlyD family protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 439 Back     alignment and organism information
>gi|190890292|ref|YP_001976834.1| protein secretion protein, HlyD family [Rhizobium etli CIAT 652] Length = 481 Back     alignment and organism information
>gi|327191612|gb|EGE58624.1| putative protein secretion protein, HlyD family [Rhizobium etli CNPAF512] Length = 481 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane fusio 2e-25
TIGR01730322 TIGR01730, RND_mfp, RND family efflux transporter, MFP 5e-05
COG1566352 COG1566, EmrA, Multidrug resistance efflux pump [Defens 8e-07
TIGR03794421 TIGR03794, NHPM_micro_HlyD, NHPM bacteriocin system sec 2e-04
pfam00529304 pfam00529, HlyD, HlyD family secretion protein 3e-04
TIGR02971327 TIGR02971, heterocyst_DevB, ABC exporter membrane fusio 0.001
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|162505 TIGR01730, RND_mfp, RND family efflux transporter, MFP subunit Back     alignment and domain information
>gnl|CDD|31754 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163506 TIGR03794, NHPM_micro_HlyD, NHPM bacteriocin system secretion protein Back     alignment and domain information
>gnl|CDD|109580 pfam00529, HlyD, HlyD family secretion protein Back     alignment and domain information
>gnl|CDD|132016 TIGR02971, heterocyst_DevB, ABC exporter membrane fusion protein, DevB family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 440 Type I secretion membrane fusion protein, HlyD [Candida
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 100.0
PRK03598331 hypothetical protein; Provisional 100.0
TIGR01000476 bacteriocin_acc bacteriocin secretion accessory protein 100.0
PRK10476348 multidrug resistance protein MdtN; Provisional 100.0
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 100.0
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 100.0
PRK11556415 multidrug efflux system subunit MdtA; Provisional 99.98
PRK11578347 macrolide transporter subunit MacA; Provisional 99.97
COG1566352 EmrA Multidrug resistance efflux pump [Defense mechanis 100.0
PRK09859385 multidrug efflux system protein MdtE; Provisional 99.95
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 99.95
TIGR02971363 heterocyst_DevB ABC exporter membrane fusion protein, D 99.95
TIGR01730333 RND_mfp efflux transporter, RND family, MFP subunit; In 99.38
PRK09783407 copper/silver efflux system membrane fusion protein Cus 99.93
TIGR00999284 8a0102 Membrane Fusion Protein cluster 2 protein; Inter 99.75
pfam00529304 HlyD HlyD family secretion protein. 95.92
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogenesis, 95.1
TIGR00717 534 rpsA ribosomal protein S1; InterPro: IPR000110 Ribosome 90.04
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogenesis, 99.74
pfam00529304 HlyD HlyD family secretion protein. 99.59
PRK0705180 hypothetical protein; Validated 97.26
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 97.09
pfam06898383 YqfD Putative stage IV sporulation protein YqfD. This f 96.93
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 96.88
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.86
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 96.85
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.83
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 96.83
KOG0559457 consensus 96.79
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 96.51
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 96.43
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.42
TIGR02876406 spore_yqfD sporulation protein YqfD; InterPro: IPR01069 96.28
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 96.25
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 96.18
PRK05704406 dihydrolipoamide succinyltransferase; Validated 96.18
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 96.17
PRK11855 549 dihydrolipoamide acetyltransferase; Reviewed 96.05
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 96.03
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 95.99
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 95.58
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 95.52
PRK09783407 copper/silver efflux system membrane fusion protein Cus 95.49
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 95.1
PRK11854630 aceF dihydrolipoamide acetyltransferase; Validated 95.07
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 94.96
PRK03598331 hypothetical protein; Provisional 94.63
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 93.97
PRK11637404 hypothetical protein; Provisional 97.53
COG0539541 RpsA Ribosomal protein S1 [Translation, ribosomal struc 90.61
PRK10476348 multidrug resistance protein MdtN; Provisional 97.51
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 95.11
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 97.32
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 97.0
PRK129991147 pyruvate carboxylase; Reviewed 96.99
PRK09282580 pyruvate carboxylase subunit B; Validated 96.98
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.96
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.88
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 96.86
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 96.84
COG4942420 Membrane-bound metallopeptidase [Cell division and chro 96.83
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.8
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 96.6
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.55
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 96.48
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 96.15
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 96.07
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 96.0
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 95.98
COG10381149 PycA Pyruvate carboxylase [Energy production and conver 95.95
PRK09439169 glucose-specific PTS system component; Provisional 95.86
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 95.12
COG3608331 Predicted deacylase [General function prediction only] 95.03
KOG0238670 consensus 94.71
KOG03691176 consensus 94.66
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 94.56
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the Succ 94.34
PRK0705180 hypothetical protein; Validated 93.64
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 92.85
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterized sub 92.41
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterized sub 92.14
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterized sub 91.95
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterized sub 91.62
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterized sub 90.97
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 96.69
PRK09510402 tolA cell envelope integrity inner membrane protein Tol 94.98
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 96.07
PRK11637404 hypothetical protein; Provisional 94.95
TIGR02063 755 RNase_R ribonuclease R; InterPro: IPR011805 This family 91.58
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 95.45
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 95.41
PRK05704406 dihydrolipoamide succinyltransferase; Validated 95.29
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 95.14
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 94.91
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 94.81
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 94.81
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 94.7
TIGR01349 584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 94.62
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 94.55
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 92.18
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 91.83
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 91.6
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 91.54
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 90.37
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 94.13
KOG0161 1930 consensus 91.01
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 94.07
pfam07888546 CALCOCO1 Calcium binding and coiled-coil domain (CALCOC 90.49
PRK09039343 hypothetical protein; Validated 94.05
pfam09726680 Macoilin Transmembrane protein. This entry is a highly 91.55
PRK09039343 hypothetical protein; Validated 90.26
COG1566352 EmrA Multidrug resistance efflux pump [Defense mechanis 91.98
KOG1029 1118 consensus 91.24
PRK11642813 exoribonuclease R; Provisional 90.98
pfam0155196 Peptidase_M23 Peptidase family M23. Members of this fam 90.02
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein; InterPro: IPR005696 Bacteriocins are antibacterial proteinaceous compounds produced by bacteria Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family; InterPro: IPR014315 Members of this protein are found mostly in the Cyanobacteria, but also in the Planctomycetes Back     alignment and domain information
>TIGR01730 RND_mfp efflux transporter, RND family, MFP subunit; InterPro: IPR006143 Gram-negative bacteria produce a number of proteins which are secreted into the growth medium by a mechanism that does not require a cleaved N-terminal signal sequence Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 protein; InterPro: IPR005695 Gram-negative bacteria have evolved transport complexes that export macromolecules and toxic substances such as heavy metals across the two membranes of the cell envelope in a single energy coupled step Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1; InterPro: IPR000110 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>pfam06898 YqfD Putative stage IV sporulation protein YqfD Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R; InterPro: IPR011805 This family consists of an exoribonuclease, ribonuclease R, also called VacB Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>KOG0161 consensus Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>pfam07888 CALCOCO1 Calcium binding and coiled-coil domain (CALCOCO1) like Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>pfam09726 Macoilin Transmembrane protein Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>KOG1029 consensus Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>pfam01551 Peptidase_M23 Peptidase family M23 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3lnn_A359 Crystal Structure Of Zneb From Cupriavidus Metallid 1e-06
3fpp_A341 Crystal Structure Of E.Coli Maca Length = 341 4e-04
>gi|299856759|pdb|3LNN|A Chain A, Crystal Structure Of Zneb From Cupriavidus Metallidurans Length = 359 Back     alignment and structure
 Score = 59.0 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 35/104 (33%), Gaps = 15/104 (14%)

Query: 311 YAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKI 370
           Y   +   +  V      ++ A    K + HV  G +ATV+F  Y D +       +  +
Sbjct: 191 YWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQ----PGKVRYV 246

Query: 371 DPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVL 414
             I+       + +  +            + +  LR G  A+  
Sbjct: 247 GQILDADTRTTKVRMVF-----------DNPDGRLRPGMFAQAT 279


>gi|228312097|pdb|3FPP|A Chain A, Crystal Structure Of E.Coli Maca Length = 341 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 3e-05
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 2e-04
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 3e-04
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 6e-04
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 7e-04
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Length = 359 Back     alignment and structure
 Score = 45.2 bits (106), Expect = 3e-05
 Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 4/62 (6%)

Query: 39 PIEISVSSSGEI-LNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLID 97
           +    +    I  +   +V++  P +G I     + G ++  G  L T   I++ DL  
Sbjct: 39 TVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFT---IDSADLAQ 95

Query: 98 LK 99
            
Sbjct: 96 AN 97


>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Length = 341 Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Length = 369 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Length = 277 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 99.92
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 99.91
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 99.92
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 99.92
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 99.68
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 97.24
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 97.21
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 97.14
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 97.08
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 97.05
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 96.99
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 96.79
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 96.78
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 96.75
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 96.68
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 96.65
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 96.27
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 96.19
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 96.06
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 95.54
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 95.48
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 95.42
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 95.37
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 93.72
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 93.48
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 93.18
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 93.03
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 91.29
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 90.15
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 90.03
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 99.4
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 97.07
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 97.03
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 96.94
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 96.94
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 96.91
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 96.89
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 96.8
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 96.68
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 96.44
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 96.42
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 96.4
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 95.68
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 95.57
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 94.74
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 94.64
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 94.6
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 94.11
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 93.87
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 93.55
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 92.85
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, myosi 97.35
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome inacti 97.02
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 96.41
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 96.35
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 96.26
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 93.08
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 95.69
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 95.38
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 94.22
3c9i_A242 Tail needle protein GP26; xenon, coiled-coil, protein f 90.41
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 94.94
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 94.88
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich fold 94.46
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 94.01
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 93.73
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 93.27
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich fold 93.08
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 94.77
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 94.71
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 93.8
1m1j_A491 Fibrinogen alpha subunit; coiled coils, disulfide rings 94.64
1m1j_A491 Fibrinogen alpha subunit; coiled coils, disulfide rings 92.72
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin 92.55
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
Probab=99.92  E-value=2.7e-24  Score=178.97  Aligned_cols=259  Identities=15%  Similarity=0.236  Sum_probs=164.2

Q ss_pred             EEEEEEEEEEEEEEEECCCEEEEECCCCCEEEEEECCCCCEEECCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             06712589997999953873898468886899998578989336978999964899888999874343323321001233
Q gi|254780386|r   37 LLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSA  116 (440)
Q Consensus        37 ~~~~~~~v~~~G~i~~~~~~~~I~s~~~G~V~~i~VkeGd~VkkGq~L~~ld~~~~~~~l~~~~~~l~~l~~~l~~~~~~  116 (440)
                      -..+..++.++|+|.|.... .|.++.+|+|.+++|++||.|++||+|++||+.+....+.+.+..+..++++++..+..
T Consensus        13 ~g~i~~tv~~~G~v~~~~~~-~v~a~~~G~V~~v~v~~G~~V~~G~~L~~id~~~~~~~~~~~~a~~~~~~~~l~~a~~~   91 (341)
T 3fpp_A           13 PGDLQQSVLATGKLDALRKV-DVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAE   91 (341)
T ss_dssp             CCCCCCEEEEEEEEEESSEE-ECCCSSCEEEEEECCCTTCEECTTCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEEEEEEEEEEE-EEECCCCEEEEEEECCCCCEECCCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98724999999999980899-99844778999999899199889998999881999999999999898876548999878


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             33222114555422356888877655467886543336554200112221122100223210112232222221023333
Q gi|254780386|r  117 LDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQ  196 (440)
Q Consensus       117 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~  196 (440)
                      ++.                                                                           .+
T Consensus        92 l~~---------------------------------------------------------------------------a~   96 (341)
T 3fpp_A           92 LKL---------------------------------------------------------------------------AR   96 (341)
T ss_dssp             HHH---------------------------------------------------------------------------HT
T ss_pred             HHH---------------------------------------------------------------------------HH
T ss_conf             887---------------------------------------------------------------------------44


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22210122222211100001110024666531012233222222222221000122333211233222122222222122
Q gi|254780386|r  197 KDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADE  276 (440)
Q Consensus       197 ~el~~~~~l~~~~~~~~~~l~~~~~~~~~~~~el~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~~l~e~~~~l~~~  276 (440)
                      .++...+.+...+..++.++.............+..                                    ....+...
T Consensus        97 ~~~~r~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~------------------------------------~~~~l~~~  140 (341)
T 3fpp_A           97 VTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGT------------------------------------IDAQIKRN  140 (341)
T ss_dssp             HHHHHHHHHHHTSSSTTHHHHHHHHHHHHTHHHHHH------------------------------------HHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHCCHHHHHHHH------------------------------------HHHHHHHH
T ss_conf             332012344203765266665554321023567888------------------------------------77799876


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEECCEEECCCCCCCC---CCCCCCCCCCCCCEEEEEEECHHHHHHCCCCCCEEEEEE
Q ss_conf             23322122222123455541168731212012221244---455421033556504775326223110158983179998
Q gi|254780386|r  277 MSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQ---SQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFP  353 (440)
Q Consensus       277 ~~~l~~l~~~l~~~~I~AP~~G~V~~l~~~~~G~~v~~---G~~l~~Ivp~~~~l~v~~~v~~~di~~i~~Gq~v~i~~~  353 (440)
                      ..........+.+..+.||++|.+..... ..|..+.+   +.++++|. +.+.+++.+.+++.++.++++|+.|.++++
T Consensus       141 ~~~~~~~~~~~~~~~i~a~~~~~~~~~~~-~~G~~v~~~~~~~~~~~i~-~~~~~~~~~~v~e~~~~~v~~g~~v~i~~~  218 (341)
T 3fpp_A          141 QASLDTAKTNLDYTRIVAPMAGEVTQITT-LQGQTVIAAQQAPNILTLA-DMSAMLVKAQVSEADVIHLKPGQKAWFTVL  218 (341)
T ss_dssp             HHHHTTTTTTTTSSEEECSSSEEEEEESS-CTTCEECCTTSCCCCEEEE-CCSEEEEEEECCGGGSTTCCTTCCCEECCS
T ss_pred             HHHHHHHHHCCCCEEEECCCCCEEEEEEE-CCCCEEECCCCCCEEEEEE-CCCCEEEEEEECHHHHHHHHCCCEEEEEEE
T ss_conf             66555555113550684686762778982-5798883378761478992-388537998658999997314753789870


Q ss_pred             ECCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEECHHHCCCCCCEECCCCEEEEEEEECEEE
Q ss_conf             12887544399999997133444677765511899999935011256785152377569999922054
Q gi|254780386|r  354 HYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTT  421 (440)
Q Consensus       354 a~~~~~~~~~~G~V~~Is~~~~~~~~~~~~~~~y~v~i~~~~~~~~~~~~~L~~Gm~~~~~I~~~~~~  421 (440)
                      .++..   .+.|+|..|+|.+.....    ...|.+.+.++.     .+..++|||++++.|.++.+.
T Consensus       219 ~~~~~---~~~g~v~~i~~~~~~~~~----~~~~~~~~~~~~-----~~~~~~~G~~v~v~i~~~~~~  274 (341)
T 3fpp_A          219 GDQLT---RYEGQIKDVLPTPEKVND----AIFYYARFEVPN-----PNGLLRLDMTAQVHIQLTDVK  274 (341)
T ss_dssp             SSSSS---CBCCCEEEECSSCCBSSS----CBCCEEEEEEEC-----SSSCCCTTCEEEEEEESCCCC
T ss_pred             CCCEE---EEEEEEEEEECCEEECCC----EEEEEEEEEECC-----CCCCCCCCEEEEEEEEECCCC
T ss_conf             22101---211599999632230576----199999997259-----765555533899999935758



>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3dtp_B 3dtp_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, merlin, actin binding, masking, regulation, SELF-inhibition cell adhesion; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 440 Type I secretion membrane fusion protein, HlyD [Candida
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetylt 0.002
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of dihydrolipoamide acetyltransferase
species: Bacillus stearothermophilus [TaxId: 1422]
 Score = 37.8 bits (88), Expect = 0.002
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 48 GEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88
           E+ N+  VVEI SP  G + +  V  G+    G  L+T +
Sbjct: 36 CEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLD 76


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target440 Type I secretion membrane fusion protein, HlyD [Candida
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomonas a 99.86
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escherichia 97.17
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase (TC 97.03
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferase {Az 96.96
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 96.84
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Es 96.68
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain alpha 96.62
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferase {Ne 96.04
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Ba 95.85
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferase {Hu 95.43
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 95.05
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [TaxId 91.52
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase (TC 96.93
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia coli 95.86
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma capric 95.78
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escherichia 95.7
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferase {Az 95.6
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferase {Hu 94.93
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus subtilis 94.71
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Ba 94.66
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain alpha 94.41
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 94.38
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Es 93.84
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferase {Ne 93.54
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 90.89
d2ix0a190 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} 94.22
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomonas a 93.38
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: HlyD-like secretion proteins
superfamily: HlyD-like secretion proteins
family: HlyD-like secretion proteins
domain: Multidrug resistance protein MexA domain
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.86  E-value=2.4e-22  Score=164.47  Aligned_cols=221  Identities=13%  Similarity=0.171  Sum_probs=143.2

Q ss_pred             EEEEEEEEEECCCEEEEECCCCCEEEEEECCCCCEEECCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             89997999953873898468886899998578989336978999964899888999874343323321001233332221
Q gi|254780386|r   43 SVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNN  122 (440)
Q Consensus        43 ~v~~~G~i~~~~~~~~I~s~~~G~V~~i~VkeGd~VkkGq~L~~ld~~~~~~~l~~~~~~l~~l~~~l~~~~~~l~~~~~  122 (440)
                      ++..+|.|.|.. ...|.|+++|+|.+++|++||.|+|||+|++||+.+....+...+.++..++++++..+        
T Consensus         3 ~~~~~G~i~a~~-~~~V~s~v~G~V~~v~V~~G~~VkkGq~L~~ld~~~~~~~l~~a~a~~~~a~~~~~r~~--------   73 (237)
T d1vf7a_           3 NTELPGRTNAFR-IAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYK--------   73 (237)
T ss_dssp             EEEEEEECEESC-EEEECCSSCEEEEECCSCSSEEECTTSEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHH--------
T ss_pred             EEEEEEEEEEEE-EEEEEEECCEEEEEEECCCCCEECCCCEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH--------
T ss_conf             799889999637-99998216789999987994998899999998238877665333233333222123454--------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             14555422356888877655467886543336554200112221122100223210112232222221023333222101
Q gi|254780386|r  123 KYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMM  202 (440)
Q Consensus       123 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~el~~~  202 (440)
                                                                                                      
T Consensus        74 --------------------------------------------------------------------------------   73 (237)
T d1vf7a_          74 --------------------------------------------------------------------------------   73 (237)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211100001110024666531012233222222222221000122333211233222122222222122233221
Q gi|254780386|r  203 KNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTI  282 (440)
Q Consensus       203 ~~l~~~~~~~~~~l~~~~~~~~~~~~el~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~~l~e~~~~l~~~~~~l~~  282 (440)
                       .+.......+.++.                                                  ..+..+.....++..
T Consensus        74 -~l~~~~~~~~~~~~--------------------------------------------------~~~~~~~~a~~~l~~  102 (237)
T d1vf7a_          74 -LLVADQAVSKQQYA--------------------------------------------------DANAAYLQSKAAVEQ  102 (237)
T ss_dssp             -HHHHTTSSCHHHHH--------------------------------------------------HHHHHHHHHHHHHHH
T ss_pred             -HHHHCCCCCCCHHH--------------------------------------------------HHHHHCCHHHHHHHH
T ss_conf             -44430543220012--------------------------------------------------222200126889999


Q ss_pred             CCCCCCCCCCCCCCEEEEECCEEECCCCCCCCCCCCCCCC-CCCCCEEEEEEECHHHHHHCC-------------CCCCE
Q ss_conf             2222212345554116873121201222124445542103-355650477532622311015-------------89831
Q gi|254780386|r  283 LEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIV-PHSKLTYIRAKVTPKQIQHVK-------------KGYTA  348 (440)
Q Consensus       283 l~~~l~~~~I~AP~~G~V~~l~~~~~G~~v~~G~~l~~Iv-p~~~~l~v~~~v~~~di~~i~-------------~Gq~v  348 (440)
                      ++..+.++.|+||++|+|..... ..|.++.+|.....+. .+...+++.+..++.++..+.             .|..+
T Consensus       103 a~~~l~~~~i~ap~~G~v~~~~~-~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~v  181 (237)
T d1vf7a_         103 ARINLRYTKVLSPISGRIGRSAV-TEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKV  181 (237)
T ss_dssp             HHHHHHTTEEECSSSEEECCCSS-CBTCEECTTCSSCSEEEECCSEEECCEEEEHHHHHHHHHHHHHTSSCEEETTEEEC
T ss_pred             HHHHHCCCCCCCCHHCEEEEEEE-CCCCEECCCCCEEEEEEECCCCCEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCEE
T ss_conf             75322024210420001125772-04848737863245899338510244150388777776542134200025677347


Q ss_pred             EEEEEECCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEECHHHCCCCCCEECCCCEEEEEEEEC
Q ss_conf             7999812887544399999997133444677765511899999935011256785152377569999922
Q gi|254780386|r  349 TVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAK  418 (440)
Q Consensus       349 ~i~~~a~~~~~~~~~~G~V~~Is~~~~~~~~~~~~~~~y~v~i~~~~~~~~~~~~~L~~Gm~~~~~I~~~  418 (440)
                      .+.++..+   ...+.|+|..|++.....+      ..|.|++.+++     ++..|+|||.++|.|.+|
T Consensus       182 ~~~~~~~~---~~~~~g~v~~i~~~vd~~t------~t~~v~~~i~n-----~~~~L~pGm~v~v~i~~g  237 (237)
T d1vf7a_         182 SLKLEDGS---QYPLEGRLEFSEVSVDEGT------GSVTIRAVFPN-----PNNELLPGMFVHAQLQEG  237 (237)
T ss_dssp             CEECTTSC---EESSCCEEESSCSCCCSSS------SEEEECBEEEC-----SSSCCCTTCEEEEEEECC
T ss_pred             EEEECCCC---CCEEEEEEEEEECCCCCCC------CEEEEEEEEEC-----CCCCCCCCCEEEEEEECC
T ss_conf             88603788---7138899999846384888------48999999989-----999688999899999459



>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 440 Type I secretion membrane fusion protein, HlyD [Ca
2ejm_A_99 (A:) Methylcrotonoyl-COA carboxylase subunit alpha 5e-05
2ejm_A_99 (A:) Methylcrotonoyl-COA carboxylase subunit alpha 0.002
1gjx_A_81 (A:) Pyruvate dehydrogenase; oxidoreductase, lipoy 1e-04
1k8m_A_93 (A:) E2 component of branched-chain ahpha-ketoacid 1e-04
2k7v_A_85 (A:) Dihydrolipoyllysine-residue acetyltransferase 1e-04
2qf7_A_1087-116579 (A:1087-1165) Pyruvate carboxylase protein; multi- 2e-04
1ghj_A_79 (A:) E2, E2, the dihydrolipoamide succinyltransfer 2e-04
1iyu_A_79 (A:) E2P, dihydrolipoamide acetyltransferase compo 2e-04
1z6h_A_72 (A:) Biotin/lipoyl attachment protein; solution st 2e-04
2jku_A_94 (A:) Propionyl-COA carboxylase alpha chain, mitoch 2e-04
3hbl_A_1069-115082 (A:1069-1150) Pyruvate carboxylase; TIM barrel, li 2e-04
3bg3_A_644-71875 (A:644-718) Pyruvate carboxylase, mitochondrial; T 3e-04
1pmr_A_80 (A:) Dihydrolipoyl succinyltransferase; 2-oxogluta 3e-04
1bdo_A_80 (A:) Acetyl-COA carboxylase; BCCPSC, carboxyl tran 4e-04
1qjo_A_80 (A:) Dihydrolipoamide acetyltransferase; lipoyl do 4e-04