254780398

254780398

dimethyladenosine transferase

GeneID in NCBI database:8209383Locus tag:CLIBASIA_01415
Protein GI in NCBI database:254780398Protein Accession:YP_003064811.1
Gene range:+(299106, 299960)Protein Length:284aa
Gene description:dimethyladenosine transferase
COG prediction:[J] Dimethyladenosine transferase (rRNA methylation)
KEGG prediction:ksgA; dimethyladenosine transferase (EC:2.1.1.-); K02528 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
SEED prediction:Dimethyladenosine transferase (EC 2.1.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Ribosome biogenesis bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
cccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHcccHHHHccccccEEEEEccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcEEEEEEEcccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccc
cccccccccHHHHHHHHcccHHHHHcHHHHccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccEEEEEEEcHHHHHHHHHHcccccccEEEEEccEEEEcHHHHcccccccEEEEcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEEEEcccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccHHHHHHHHHHHHccccccc
mtmnnkshSLKTILSHYKIipkkymgqnflLDLNILKKIAessgsldgitvieigagpgNLTQMLLTLGARKVIVIEKdqqffpilkdissqhpnrleiIQDDALKVDfekffnisspiriianlpynigTRLLFNWisadtwppfWESLTLLFQKEVGERitaqknsphygrlsvLTGWRTKAtmmfdisphvffpspkvtstvihfiphlnpipcCLESLKKITQEAFGKRRKTLRQSLKRlggenllhqagietnlraenlsiedFCRITniltdnqdiai
mtmnnkshslKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERitaqknsphygrlSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKrlggenllhqagietnlraenlsiedfcritniltdnqdiai
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
***********TILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQ****
**********KTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
******SHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI
MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIAI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target284 dimethyladenosine transferase [Candidatus Liberibacter
315122190283 dimethyladenosine transferase [Candidatus Liberibacter 1 1e-128
222085448276 dimethyladenosine transferase [Agrobacterium radiobacte 1 7e-91
218673561275 dimethyladenosine transferase [Rhizobium etli GR56] Len 1 1e-90
241203944275 dimethyladenosine transferase [Rhizobium leguminosarum 1 2e-90
227821471296 dimethyladenosine transferase [Sinorhizobium fredii NGR 1 4e-90
327188008275 dimethyladenosine transferase (16S rRNA dimethylase) pr 1 5e-90
150395984274 dimethyladenosine transferase [Sinorhizobium medicae WS 1 2e-89
190891131275 dimethyladenosine transferase (16S rRNA dimethylase) pr 1 2e-89
15964902274 dimethyladenosine transferase [Sinorhizobium meliloti 1 1 4e-89
325292482276 dimethyladenosine transferase [Agrobacterium sp. H13-3] 1 7e-89
>gi|315122190|ref|YP_004062679.1| dimethyladenosine transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 283 Back     alignment and organism information
 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/283 (76%), Positives = 249/283 (87%)

Query: 1   MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGSLDGITVIEIGAGPGN 60
           M   NK +SLK ILS Y I+P K MGQNFL D+N+LKKIA +SGSL+G+T IEIG GPGN
Sbjct: 1   MISKNKKNSLKNILSRYDIVPHKNMGQNFLFDINLLKKIATTSGSLNGVTAIEIGPGPGN 60

Query: 61  LTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDALKVDFEKFFNISSPIR 120
           LTQ+LL LGA+KVIV+EKD QF PIL +IS Q+PNRLEIIQ DALK+DF++  +I +PIR
Sbjct: 61  LTQILLELGAQKVIVVEKDPQFLPILNNISLQYPNRLEIIQGDALKIDFKELSHIPAPIR 120

Query: 121 IIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGW 180
           II+NLPYNIGTRLLFNWI++ TWPPFWESLTLLFQKEVG+RITAQKN PHYGRLS+LT W
Sbjct: 121 IISNLPYNIGTRLLFNWITSSTWPPFWESLTLLFQKEVGKRITAQKNDPHYGRLSILTSW 180

Query: 181 RTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESLKKITQEAFGKRRKTLRQS 240
           RTKA +MFDI PHVFFP PK+TSTV+HF PHLNPIPCCLESLKKITQEAFGKRRKTLRQS
Sbjct: 181 RTKAKIMFDIPPHVFFPKPKITSTVVHFTPHLNPIPCCLESLKKITQEAFGKRRKTLRQS 240

Query: 241 LKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQDIA 283
           LK L GENLL QAGIE++LRAENLSIEDFCRITNI ++N +++
Sbjct: 241 LKPLEGENLLRQAGIESSLRAENLSIEDFCRITNIFSENNNVS 283


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085448|ref|YP_002543978.1| dimethyladenosine transferase [Agrobacterium radiobacter K84] Length = 276 Back     alignment and organism information
>gi|218673561|ref|ZP_03523230.1| dimethyladenosine transferase [Rhizobium etli GR56] Length = 275 Back     alignment and organism information
>gi|241203944|ref|YP_002975040.1| dimethyladenosine transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 275 Back     alignment and organism information
>gi|227821471|ref|YP_002825441.1| dimethyladenosine transferase [Sinorhizobium fredii NGR234] Length = 296 Back     alignment and organism information
>gi|327188008|gb|EGE55238.1| dimethyladenosine transferase (16S rRNA dimethylase) protein [Rhizobium etli CNPAF512] Length = 275 Back     alignment and organism information
>gi|150395984|ref|YP_001326451.1| dimethyladenosine transferase [Sinorhizobium medicae WSM419] Length = 274 Back     alignment and organism information
>gi|190891131|ref|YP_001977673.1| dimethyladenosine transferase (16S rRNA dimethylase) protein [Rhizobium etli CIAT 652] Length = 275 Back     alignment and organism information
>gi|15964902|ref|NP_385255.1| dimethyladenosine transferase [Sinorhizobium meliloti 1021] Length = 274 Back     alignment and organism information
>gi|325292482|ref|YP_004278346.1| dimethyladenosine transferase [Agrobacterium sp. H13-3] Length = 276 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target284 dimethyladenosine transferase [Candidatus Liberibacter
PRK00274272 PRK00274, ksgA, 16S ribosomal RNA methyltransferase Ksg 3e-91
TIGR00755253 TIGR00755, ksgA, dimethyladenosine transferase 2e-63
PRK14896258 PRK14896, ksgA, 16S ribosomal RNA methyltransferase Ksg 5e-48
KOG0821326 KOG0821, KOG0821, KOG0821, Predicted ribosomal RNA aden 1e-40
pfam00398258 pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase 7e-40
COG0030259 COG0030, KsgA, Dimethyladenosine transferase (rRNA meth 3e-69
smart00650169 smart00650, rADc, Ribosomal RNA adenine dimethylases 2e-44
PTZ00338294 PTZ00338, PTZ00338, dimethyladenosine transferase-like 5e-32
KOG0820315 KOG0820, KOG0820, KOG0820, Ribosomal RNA adenine dimeth 4e-27
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 3e-05
COG4076252 COG4076, COG4076, Predicted RNA methylase [General func 0.001
COG2263198 COG2263, COG2263, Predicted RNA methylase [Translation, 4e-04
>gnl|CDD|178953 PRK00274, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>gnl|CDD|162023 TIGR00755, ksgA, dimethyladenosine transferase Back     alignment and domain information
>gnl|CDD|184890 PRK14896, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>gnl|CDD|36039 KOG0821, KOG0821, KOG0821, Predicted ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|109456 pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase Back     alignment and domain information
>gnl|CDD|30380 COG0030, KsgA, Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|128898 smart00650, rADc, Ribosomal RNA adenine dimethylases Back     alignment and domain information
>gnl|CDD|185564 PTZ00338, PTZ00338, dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|36038 KOG0820, KOG0820, KOG0820, Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|33834 COG4076, COG4076, Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 284 dimethyladenosine transferase [Candidatus Liberibacter
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 100.0
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 100.0
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 100.0
PTZ00338296 dimethyladenosine transferase; Provisional 100.0
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 100.0
KOG0821326 consensus 100.0
KOG0820315 consensus 100.0
smart00650169 rADc Ribosomal RNA adenine dimethylases. 100.0
pfam05175170 MTS Methyltransferase small domain. This domain is foun 98.99
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 98.79
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.35
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.25
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 97.99
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.96
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.89
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 97.68
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 97.67
KOG1270282 consensus 97.64
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 97.48
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 97.46
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 97.38
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 97.07
COG0286489 HsdM Type I restriction-modification system methyltrans 95.8
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 94.78
KOG2671421 consensus 93.1
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 92.77
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 92.38
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 99.4
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.69
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 98.68
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.67
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.63
PRK07402196 precorrin-6B methylase; Provisional 98.63
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.62
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.59
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.4
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.24
KOG2904328 consensus 97.99
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 97.95
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.94
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 97.82
COG1041347 Predicted DNA modification methylase [DNA replication, 97.48
COG4106257 Tam Trans-aconitate methyltransferase [General function 97.46
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 97.44
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 97.12
COG2521287 Predicted archaeal methyltransferase [General function 97.05
KOG3191209 consensus 96.92
KOG2187534 consensus 96.11
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 95.41
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 94.93
pfam05206256 TRM13 Methyltransferase TRM13. This is a family of euka 93.98
PRK11727326 putative SAM-dependent methyltransferase; Provisional 92.29
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.97
COG4123248 Predicted O-methyltransferase [General function predict 98.89
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.88
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.81
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.8
PRK08317241 hypothetical protein; Provisional 98.73
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.71
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.69
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 98.67
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.64
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 98.53
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.51
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.46
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.46
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.45
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.44
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 98.43
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.41
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 98.4
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.36
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.33
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.32
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 98.3
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 98.27
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.27
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 98.17
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.11
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 98.1
COG4076252 Predicted RNA methylase [General function prediction on 97.97
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.95
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 97.92
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 97.89
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 97.84
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.8
KOG1500 517 consensus 97.8
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 97.79
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 97.76
PHA02056279 putative methyltransferase 97.72
PRK04457262 spermidine synthase; Provisional 97.72
PRK06202233 hypothetical protein; Provisional 97.69
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 97.66
PRK05785225 hypothetical protein; Provisional 97.61
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 97.59
PRK06922679 hypothetical protein; Provisional 97.56
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.48
KOG3420185 consensus 97.47
KOG2915314 consensus 97.47
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 97.45
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 97.44
COG4122219 Predicted O-methyltransferase [General function predict 97.44
KOG1499346 consensus 97.42
COG2520341 Predicted methyltransferase [General function predictio 97.41
PRK11036256 putative metallothionein SmtA; Provisional 97.4
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 97.35
KOG1540296 consensus 97.34
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 97.32
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 97.29
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 97.28
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 97.21
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 97.04
PRK11207198 tellurite resistance protein TehB; Provisional 96.99
pfam03848192 TehB Tellurite resistance protein TehB. 96.96
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 96.86
PRK00811283 spermidine synthase; Provisional 96.78
pfam02636240 DUF185 Uncharacterized ACR, COG1565. This family contai 96.71
KOG2361264 consensus 96.67
PRK03612516 spermidine synthase; Provisional 96.5
COG1565370 Uncharacterized conserved protein [Function unknown] 96.46
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 96.46
KOG1501 636 consensus 96.07
PRK10901428 16S rRNA methyltransferase B; Provisional 96.0
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 95.99
pfam05219265 DREV DREV methyltransferase. This family contains DREV 95.95
PRK12335289 tellurite resistance protein TehB; Provisional 95.94
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 95.8
PRK01581363 speE spermidine synthase; Validated 95.8
KOG2899288 consensus 95.71
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 95.64
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 95.58
KOG1663237 consensus 95.55
COG1092393 Predicted SAM-dependent methyltransferases [General fun 95.51
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 95.43
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 95.39
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 94.87
KOG1271227 consensus 94.81
KOG1975389 consensus 94.72
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 94.57
COG4262508 Predicted spermidine synthase with an N-terminal membra 94.4
PRK00536262 speE spermidine synthase; Provisional 94.39
KOG3010261 consensus 94.36
pfam10294171 Methyltransf_16 Putative methyltransferase. 94.32
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 94.25
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 94.18
TIGR00006323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 94.16
COG3897218 Predicted methyltransferase [General function predictio 94.12
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 94.1
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 94.03
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 93.83
KOG1661237 consensus 93.8
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 93.64
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 93.62
KOG3924419 consensus 93.59
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 93.57
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 93.55
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 93.42
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 92.91
PRK10742250 putative methyltransferase; Provisional 92.74
KOG2651476 consensus 92.73
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 92.48
KOG1541270 consensus 91.99
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 91.95
KOG3178342 consensus 91.71
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 91.64
KOG1227351 consensus 90.59
KOG1709271 consensus 90.57
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.27
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 98.12
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 97.85
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.81
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 97.66
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 97.66
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 96.17
TIGR03438301 probable methyltransferase. This model represents a dis 95.9
pfam00145319 DNA_methylase C-5 cytosine-specific DNA methylase. 94.54
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 94.33
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 93.91
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 91.84
PRK09496 455 trkA potassium transporter peripheral membrane componen 90.98
KOG0822649 consensus 90.65
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 97.97
KOG4300252 consensus 94.67
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 91.77
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 90.65
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 97.2
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 93.57
KOG2730263 consensus 95.85
PRK04184 533 DNA topoisomerase VI subunit B; Validated 93.21
PRK05179122 rpsM 30S ribosomal protein S13; Validated 91.48
TIGR03631113 bact_S13 30S ribosomal protein S13. This model describe 90.71
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>KOG0821 consensus Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>pfam05206 TRM13 Methyltransferase TRM13 Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>pfam02636 DUF185 Uncharacterized ACR, COG1565 Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>KOG1501 consensus Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>KOG3924 consensus Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2651 consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>KOG1227 consensus Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG0822 consensus Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342 Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK05179 rpsM 30S ribosomal protein S13; Validated Back     alignment and domain information
>TIGR03631 bact_S13 30S ribosomal protein S13 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target284 dimethyladenosine transferase [Candidatus Liberibacter
1qyr_A252 2.1 Angstrom Crystal Structure Of Ksga: A Universal 1e-35
3fuu_A271 T. Thermophilus 16s Rrna A1518 And A1519 Methyltran 1e-32
3fut_A271 Apo-Form Of T. Thermophilus 16s Rrna A1518 And A151 5e-32
3ftc_A249 Crystal Structure Of A. Aeolicus Ksga At 1.72-Angst 3e-30
1zq9_A285 Crystal Structure Of Human Dimethyladenosine Transf 1e-20
3grr_A295 Crystal Structure Of The Complex Between S-Adenosyl 1e-20
2h1r_A299 Crystal Structure Of A Dimethyladenosine Transferas 3e-19
3fyc_A265 Crystal Structure Of Dim1 From The Thermophilic Arc 4e-15
3fyd_A263 Crystal Structure Of Dim1 From The Thermophilic Arc 6e-15
2erc_A244 Crystal Structure Of Ermc' A Rrna-Methyl Transferas 2e-06
1yub_A245 Solution Structure Of An Rrna Methyltransferase (Er 8e-06
>gi|50513341|pdb|1QYR|A Chain A, 2.1 Angstrom Crystal Structure Of Ksga: A Universally Conserved Adenosine Dimethyltransferase Length = 252 Back     alignment and structure
 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 84/255 (32%), Positives = 124/255 (48%), Gaps = 6/255 (2%)

Query: 27  QNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPIL 86
           QNFL D  ++  I  +     G  ++EIG G   LT+  +     ++ VIE D+     L
Sbjct: 1   QNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEP-VGERLDQLTVIELDRDLAARL 59

Query: 87  KDISSQHPNRLEIIQDDALKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPF 146
           +      P      QD       E    +  P+R+  NLPYNI T L+F+  S   +   
Sbjct: 60  QTHPFLGPKLTIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFS---YTDA 116

Query: 147 WESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVI 206
              +  + QKEV  R+ A  NS  YGRLSV+  +      + ++ P  F P PKV S V+
Sbjct: 117 IADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCNVIPVLEVPPSAFTPPPKVDSAVV 176

Query: 207 HFIPHLNPIP--CCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENL 264
             +PH         +  L +IT EAF +RRKT+R SL  L    +L   GI+  +RAEN+
Sbjct: 177 RLVPHATMPHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTGMGIDPAMRAENI 236

Query: 265 SIEDFCRITNILTDN 279
           S+  +C++ N L +N
Sbjct: 237 SVAQYCQMANYLAEN 251


gi|226192685|pdb|3FUU|A Chain A, T. Thermophilus 16s Rrna A1518 And A1519 Methyltransferase (Ksga) In Complex With Adenosine In Space Group P212121 Length = 271 Back     alignment and structure
>gi|226192683|pdb|3FUT|A Chain A, Apo-Form Of T. Thermophilus 16s Rrna A1518 And A1519 Methyltransferase (Ksga) In Space Group P21212 Length = 271 Back     alignment and structure
>gi|225734155|pdb|3FTC|A Chain A, Crystal Structure Of A. Aeolicus Ksga At 1.72-Angstrom Resolution Length = 249 Back     alignment and structure
>gi|67463766|pdb|1ZQ9|A Chain A, Crystal Structure Of Human Dimethyladenosine Transferase Length = 285 Back     alignment and structure
>gi|292659595|pdb|3GRR|A Chain A, Crystal Structure Of The Complex Between S-Adenosyl Homocysteine And Methanocaldococcus Jannaschi Dim1. Length = 295 Back     alignment and structure
>gi|110590504|pdb|2H1R|A Chain A, Crystal Structure Of A Dimethyladenosine Transferase From Plasmodium Falciparum Length = 299 Back     alignment and structure
>gi|242556502|pdb|3FYC|A Chain A, Crystal Structure Of Dim1 From The Thermophilic Archeon, Methanocaldococcus Jannaschi Length = 265 Back     alignment and structure
>gi|242556505|pdb|3FYD|A Chain A, Crystal Structure Of Dim1 From The Thermophilic Archeon, Methanocaldococcus Jannaschi Length = 263 Back     alignment and structure
gi|4699789|pdb|2ERC|A Chain A, Crystal Structure Of Ermc' A Rrna-Methyl Transferase Length = 244 Back     alignment and structure
gi|157834333|pdb|1YUB|A Chain A, Solution Structure Of An Rrna Methyltransferase (Ermam) That Confers Macrolide-Lincosamide-Streptogramin Antibiotic Resistance, Nmr, Minimized Average Structure Length = 245 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target284 dimethyladenosine transferase [Candidatus Liberibacter
1qyr_A252 KSGA, high level kasugamycin resistance protein, S-; ad 1e-58
3gru_A295 Dimethyladenosine transferase; rossman fold, ribosomal 7e-52
3fyd_A263 Probable dimethyladenosine transferase; rossman fold, r 4e-44
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 5e-43
2h1r_A299 Dimethyladenosine transferase, putative; SGC toronto di 6e-41
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like fold 6e-40
3fut_A271 Dimethyladenosine transferase; methyltransferase, dimet 1e-38
1zq9_A285 Probable dimethyladenosine transferase; SGC, structural 1e-36
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NMR {St 5e-30
2qm3_A373 Predicted methyltransferase; putative methyltransferase 3e-05
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 4e-04
3b3f_A341 Histone-arginine methyltransferase CARM1; protein argin 4e-04
3opn_A232 Putative hemolysin; structural genomics, PSI-2, protein 5e-04
3b3j_A480 Histone-arginine methyltransferase CARM1; protein argin 5e-04
1or8_A340 Protein arginine N-methyltransferase 1; protein arginin 8e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltransfera 2e-04
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreductase, P 0.001
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 0.002
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding domain, 0.001
2gci_A 360 Probable alpha-methylacyl-COA racemase MCR; COA transfe 0.004
>1qyr_A KSGA, high level kasugamycin resistance protein, S-; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 Length = 252 Back     alignment and structure
 Score =  221 bits (564), Expect = 1e-58
 Identities = 86/256 (33%), Positives = 130/256 (50%), Gaps = 8/256 (3%)

Query: 27  QNFLLDLNILKKIAESSGSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPIL 86
           QNFL D  ++  I  +     G  ++EIG G   LT+ +      ++ VIE D+     L
Sbjct: 1   QNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGE-RLDQLTVIELDRDLAARL 59

Query: 87  KDISSQHPNRLEIIQDDALKVDFEKFFN-ISSPIRIIANLPYNIGTRLLFNWISADTWPP 145
           +      P  L I Q DA+  +F +    +  P+R+  NLPYNI T L+F+     ++  
Sbjct: 60  QTHPFLGPK-LTIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNISTPLMFHL---FSYTD 115

Query: 146 FWESLTLLFQKEVGERITAQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTV 205
               +  + QKEV  R+ A  NS  YGRLSV+  +      + ++ P  F P PKV S V
Sbjct: 116 AIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCNVIPVLEVPPSAFTPPPKVDSAV 175

Query: 206 IHFIPHLNP--IPCCLESLKKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAEN 263
           +  +PH         +  L +IT EAF +RRKT+R SL  L    +L   GI+  +RAEN
Sbjct: 176 VRLVPHATMPHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTGMGIDPAMRAEN 235

Query: 264 LSIEDFCRITNILTDN 279
           +S+  +C++ N L +N
Sbjct: 236 ISVAQYCQMANYLAEN 251


>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assembly S-adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Length = 295 Back     alignment and structure
>3fyd_A Probable dimethyladenosine transferase; rossman fold, rRNA methylase, ribosomal assembly, methyltransferase, RNA-binding; 1.75A {Methanocaldococcus jannaschii} PDB: 3fyc_A* Length = 263 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Length = 244 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Length = 299 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, antibiotic resistance, methyltransferase; 1.44A {Aquifex aeolicus VF5} PDB: 3ftc_A 3fte_A 3ftf_A* Length = 249 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus HB8} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Length = 271 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Length = 285 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Length = 245 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Length = 373 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>3b3f_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, catalytic domain, alternative splicing, chromatin regulator; HET: SAH; 2.20A {Rattus norvegicus} PDB: 3b3g_A 2v74_B* 2v7e_A Length = 341 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Length = 232 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, alternative splicing; 2.55A {Rattus norvegicus} Length = 480 Back     alignment and structure
>1or8_A Protein arginine N-methyltransferase 1; protein arginine methylation, adoMet-dependent methylation, transferase; HET: SAH; 2.35A {Rattus norvegicus} SCOP: c.66.1.6 PDB: 1orh_A* 1ori_A* Length = 340 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Length = 185 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Length = 328 Back     alignment and structure
>2gci_A Probable alpha-methylacyl-COA racemase MCR; COA transferase, proton transfer, coenzyme A, isomerase; HET: MRR; 1.60A {Mycobacterium tuberculosis} SCOP: c.123.1.1 PDB: 2gce_A* 1x74_A* 2gd0_A* 2gd2_A* 2gd6_A* Length = 360 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target284 dimethyladenosine transferase [Candidatus Liberibacter
3gru_A295 Dimethyladenosine transferase; rossman fold, ribosomal 100.0
3fut_A271 Dimethyladenosine transferase; methyltransferase, dimet 100.0
1zq9_A285 Probable dimethyladenosine transferase; SGC, structural 100.0
1qyr_A252 KSGA, high level kasugamycin resistance protein, S-; ad 100.0
2h1r_A299 Dimethyladenosine transferase, putative; SGC toronto di 100.0
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like fold 100.0
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 100.0
1i4w_A353 Mitochondrial replication protein MTF1; mitochondrial t 100.0
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NMR {St 100.0
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 99.54
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 99.23
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 99.16
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransferase 99.09
3lpm_A259 Putative methyltransferase; structural genomics, protei 99.06
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 99.02
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 98.96
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 98.96
2qm3_A373 Predicted methyltransferase; putative methyltransferase 98.93
1vbf_A