254780399

254780399

DNA mismatch repair protein

GeneID in NCBI database:8209384Locus tag:CLIBASIA_01420
Protein GI in NCBI database:254780399Protein Accession:YP_003064812.1
Gene range:+(300089, 301873)Protein Length:594aa
Gene description:DNA mismatch repair protein
COG prediction:[L] DNA mismatch repair enzyme (predicted ATPase)
KEGG prediction:mutL; DNA mismatch repair protein; K03572 DNA mismatch repair protein MutL
SEED prediction:DNA mismatch repair protein MutL
Pathway involved in KEGG:Mismatch repair [PATH:las03430]
Subsystem involved in SEED:DNA repair, bacterial MutL-MutS system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
cccccccHHHHHHHccccHHccHHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEEEccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHcEEEEEEEEcccccEEEEEEcccccccEEEccccccEEEEEEEccccccHHHHHHHcHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHHEEEEEccccEEEEEEEEccccccccccEEEEEEccEEEccHHHHHHHHHHHHHHccccccEEEEEEEEccHHHccccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHcc
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEHHHccEEEEEEccccccHHHHHHHccccccccccHHHcccccccccccHHHHHHcccEEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEEccccccHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEccccccccHHHHHHHHHcHHHHHHcccccccccccEEEEEEEcccccccccccEEEEEccEEcccHHHHHHHHHHHHccccccccccEEEEEEcccccEEccccccccccEEccHHHHHHHHHHHHHHHHHHccccccccHcHccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHccEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHcccccHHHcccccEEEEccHHHHHHHHHHHHHHHHcccEEEEccccEEEEEEccHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHccccccccccccEEEEEcHHHHHHHHcc
MKIRKLSEKIINQIAageiierpSIAIKELIENSLDAESSRVETVIagggksffqitdngfgmtseeipMAVQRHCTSkisddfsnihtfgfrgealpsigavshltlmsrppqnntgaqiaisgekissvrpvamnpgtivEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSnrykmnfqstngnfperISQVIGEDFINNAVELneksneitlqgytgiptfnrgnanqFYVFINGRTVQDKFILSTIRTAYaetiplgryPVVVLLLEidprqvdvnvhpaksyirfrnptIIRNFIIQSIQKAINKKGISTSSVLSKKMISSfhqdnapkthlpkyATSLTNTQEKLFLQenrlstndllpsddptysedndpveeseaTHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDfnstkitsqtlltpEIIDLLEGECALIMEHDEDLHRLgikaerfgpnaiaireipailskkniPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYgsirsgrkMQSIEMNRLLREmeknpnssqcnhgrptfikLKLSDIEKLFGR
MKIRKLSEKIINqiaageiierpsIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARlnflkseqvetNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAyaetiplgRYPVVVLLLEIDPrqvdvnvhpaksyirfrnptiIRNFIIQSIQKAINKKGISTSSVLSKKMISSFhqdnapktHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNStkitsqtlltpEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIreipailskkniPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEknpnssqcnhgrptfiklklsdieklfgr
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRdiideiidSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAIN********************************************************************************IACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDF*****TSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSS***TLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDD***************THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREM*********NHGRPTFIKLKLSDIEKLFGR
*KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKG***********************************************************************THYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR
MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLLTPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target594 DNA mismatch repair protein [Candidatus Liberibacter as
315122189600 DNA mismatch repair protein [Candidatus Liberibacter so 1 0.0
241203286600 DNA mismatch repair protein [Rhizobium leguminosarum bv 1 0.0
116250684600 DNA mismatch repair protein [Rhizobium leguminosarum bv 1 1e-180
190890558606 DNA mismatch repair protein [Rhizobium etli CIAT 652] L 1 1e-180
209548102600 DNA mismatch repair protein [Rhizobium leguminosarum bv 1 1e-180
222147678617 DNA mismatch repair protein [Agrobacterium vitis S4] Le 1 1e-179
86356494610 DNA mismatch repair protein [Rhizobium etli CFN 42] Len 1 1e-178
218682547600 DNA mismatch repair protein [Rhizobium etli CIAT 894] L 1 1e-178
222085025606 DNA mismatch repair protein [Agrobacterium radiobacter 1 1e-178
227821008600 DNA mismatch repair protein [Sinorhizobium fredii NGR23 1 1e-177
>gi|315122189|ref|YP_004062678.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 600 Back     alignment and organism information
 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/597 (78%), Positives = 526/597 (88%), Gaps = 4/597 (0%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           MKIRKLSEKI+NQIAAGEIIERP+IAIKELIENSLDAES+ +ETVI+GGGKSFFQITDNG
Sbjct: 5   MKIRKLSEKIVNQIAAGEIIERPAIAIKELIENSLDAESTCIETVISGGGKSFFQITDNG 64

Query: 61  FGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQ 120
           FGMTSEEI MAVQRHCTSKI D+FSNI TFGFRGEALPSIGAV+HLTLMSR PQNNTGAQ
Sbjct: 65  FGMTSEEIQMAVQRHCTSKIFDNFSNICTFGFRGEALPSIGAVAHLTLMSRSPQNNTGAQ 124

Query: 121 IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIAYP 180
           I ISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQ+ETNLI +VIRRMAIAYP
Sbjct: 125 ITISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQIETNLIANVIRRMAIAYP 184

Query: 181 KVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYTGIP 240
            V FTFST K+NRY M+F+ST+GNFP+RISQVIGEDFINNAVE+NE S  ITL+GY GIP
Sbjct: 185 AVRFTFSTTKNNRYTMDFKSTDGNFPDRISQVIGEDFINNAVEINETSPNITLRGYAGIP 244

Query: 241 TFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVH 300
           TFNRGNANQ YVF+NGR +QDK ILSTIR AY+ETIPL RYPV+VLLLEI+P QVDVNVH
Sbjct: 245 TFNRGNANQLYVFVNGRIIQDKLILSTIRIAYSETIPLRRYPVIVLLLEINPTQVDVNVH 304

Query: 301 PAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISSFHQDNAPKTHLPKYAT 360
           PAKS +RFR+P+++RNFIIQSIQK+INKK   TSS+LS KMISSFHQ+NA K     Y  
Sbjct: 305 PAKSDVRFRDPSMVRNFIIQSIQKSINKKRNFTSSILSNKMISSFHQENAEKFRPITYEH 364

Query: 361 SL--TNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEESEATHYQLGIACAQIHQNYI 418
               +++QEKL LQEN LST +LL +++  + +DN  + ++  ++Y LG+ACAQIHQNYI
Sbjct: 365 KAIPSHSQEKLVLQENNLSTKELLTTNNKYFMDDNS-INDTTTSNYPLGMACAQIHQNYI 423

Query: 419 ISQTTDGLVIVDQHAAHERLIFEKMRQDFN-STKITSQTLLTPEIIDLLEGECALIMEHD 477
           ISQT D L+IVDQHAAHERLIFEKMRQDFN + KITSQTLL PEIIDLLEGECALI+EHD
Sbjct: 424 ISQTYDELIIVDQHAAHERLIFEKMRQDFNINDKITSQTLLIPEIIDLLEGECALILEHD 483

Query: 478 EDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDIIDEIIDSSTTYTLQDRIENIL 537
           EDL RLG+  ERFG NAIAIREIPAILSK N+ QLLRDI+DEII+++T   L D+I+ IL
Sbjct: 484 EDLRRLGVTVERFGLNAIAIREIPAILSKNNVSQLLRDIVDEIIENNTKNNLTDKIDKIL 543

Query: 538 ATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHGRPTFIKLKLSDIEKLFGR 594
           ATMACYGSIRSGRKM   EMNRLLREME+N NSSQCNHGRPTFIKLKLSDIEKLFGR
Sbjct: 544 ATMACYGSIRSGRKMHLTEMNRLLREMEQNNNSSQCNHGRPTFIKLKLSDIEKLFGR 600


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203286|ref|YP_002974382.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 600 Back     alignment and organism information
>gi|116250684|ref|YP_766522.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. viciae 3841] Length = 600 Back     alignment and organism information
>gi|190890558|ref|YP_001977100.1| DNA mismatch repair protein [Rhizobium etli CIAT 652] Length = 606 Back     alignment and organism information
>gi|209548102|ref|YP_002280019.1| DNA mismatch repair protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 600 Back     alignment and organism information
>gi|222147678|ref|YP_002548635.1| DNA mismatch repair protein [Agrobacterium vitis S4] Length = 617 Back     alignment and organism information
>gi|86356494|ref|YP_468386.1| DNA mismatch repair protein [Rhizobium etli CFN 42] Length = 610 Back     alignment and organism information
>gi|218682547|ref|ZP_03530148.1| DNA mismatch repair protein [Rhizobium etli CIAT 894] Length = 600 Back     alignment and organism information
>gi|222085025|ref|YP_002543554.1| DNA mismatch repair protein [Agrobacterium radiobacter K84] Length = 606 Back     alignment and organism information
>gi|227821008|ref|YP_002824978.1| DNA mismatch repair protein [Sinorhizobium fredii NGR234] Length = 600 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target594 DNA mismatch repair protein [Candidatus Liberibacter as
PRK00095617 PRK00095, mutL, DNA mismatch repair protein; Reviewed 0.0
COG0323638 COG0323, MutL, DNA mismatch repair enzyme (predicted AT 1e-157
TIGR00585312 TIGR00585, mutl, DNA mismatch repair protein MutL 1e-81
KOG1979694 KOG1979, KOG1979, KOG1979, DNA mismatch repair protein 7e-60
KOG1977 1142 KOG1977, KOG1977, KOG1977, DNA mismatch repair protein 3e-21
pfam08676142 pfam08676, MutL_C, MutL C terminal dimerization domain 3e-43
smart00853136 smart00853, MutL_C, MutL C terminal dimerisation domain 1e-36
KOG1978672 KOG1978, KOG1978, KOG1978, DNA mismatch repair protein 2e-13
pfam01119118 pfam01119, DNA_mis_repair, DNA mismatch repair protein, 6e-36
cd03482123 cd03482, MutL_Trans_MutL, MutL_Trans_MutL: transducer d 5e-33
cd00782122 cd00782, MutL_Trans, MutL_Trans: transducer domain, hav 2e-29
cd00329107 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer doma 6e-16
cd03483127 cd03483, MutL_Trans_MLH1, MutL_Trans_MLH1: transducer d 1e-12
cd03484142 cd03484, MutL_Trans_hPMS_2_like, MutL_Trans_hPMS2_like: 2e-06
cd03485132 cd03485, MutL_Trans_hPMS_1_like, MutL_Trans_hPMS1_like: 1e-04
KOG1978672 KOG1978, KOG1978, KOG1978, DNA mismatch repair protein 2e-29
KOG19771142 KOG1977, KOG1977, KOG1977, DNA mismatch repair protein 2e-08
>gnl|CDD|178860 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information
>gnl|CDD|30671 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161941 TIGR00585, mutl, DNA mismatch repair protein MutL Back     alignment and domain information
>gnl|CDD|37190 KOG1979, KOG1979, KOG1979, DNA mismatch repair protein - MLH1 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37188 KOG1977, KOG1977, KOG1977, DNA mismatch repair protein - MLH3 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|149660 pfam08676, MutL_C, MutL C terminal dimerization domain Back     alignment and domain information
>gnl|CDD|129086 smart00853, MutL_C, MutL C terminal dimerisation domain Back     alignment and domain information
>gnl|CDD|37189 KOG1978, KOG1978, KOG1978, DNA mismatch repair protein - MLH2/PMS1/Pms2 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|144638 pfam01119, DNA_mis_repair, DNA mismatch repair protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|48470 cd03482, MutL_Trans_MutL, MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL Back     alignment and domain information
>gnl|CDD|48466 cd00782, MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>gnl|CDD|73195 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>gnl|CDD|48471 cd03483, MutL_Trans_MLH1, MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1) Back     alignment and domain information
>gnl|CDD|48472 cd03484, MutL_Trans_hPMS_2_like, MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2) Back     alignment and domain information
>gnl|CDD|48473 cd03485, MutL_Trans_hPMS_1_like, MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2 Back     alignment and domain information
>gnl|CDD|37189 KOG1978, KOG1978, KOG1978, DNA mismatch repair protein - MLH2/PMS1/Pms2 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|37188 KOG1977, KOG1977, KOG1977, DNA mismatch repair protein - MLH3 family [Replication, recombination and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 594 DNA mismatch repair protein [Candidatus Liberibacter as
PRK00095612 mutL DNA mismatch repair protein; Reviewed 100.0
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 100.0
KOG1978672 consensus 100.0
TIGR00585367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 100.0
KOG1977 1142 consensus 100.0
PRK05218612 heat shock protein 90; Provisional 99.08
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 98.9
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 98.79
TIGR01059 818 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA top 98.67
COG0187635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topois 98.62
TIGR01058655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 98.1
KOG1979694 consensus 100.0
pfam08676142 MutL_C MutL C terminal dimerization domain. MutL and Mu 100.0
smart00853136 MutL_C MutL C terminal dimerisation domain. MutL and Mu 99.95
cd03482123 MutL_Trans_MutL MutL_Trans_MutL: transducer domain, hav 100.0
cd03483127 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain, hav 99.97
cd00782122 MutL_Trans MutL_Trans: transducer domain, having a ribo 99.97
pfam01119118 DNA_mis_repair DNA mismatch repair protein, C-terminal 99.97
cd03484142 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: transduce 99.96
cd03485132 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: transduce 99.95
cd03486141 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain, hav 99.95
cd00329107 TopoII_MutL_Trans MutL_Trans: transducer domain, having 99.86
PRK04184533 DNA topoisomerase VI subunit B; Validated 99.36
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 99.36
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 99.16
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 98.71
PTZ00130 824 heat shock protein 90; Provisional 98.56
TIGR01055647 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IP 98.27
PTZ00109 941 DNA gyrase subunit b; Provisional 98.24
KOG0019656 consensus 97.66
KOG0020785 consensus 97.07
PTZ00108 1506 DNA topoisomerase II; Provisional 96.55
PRK05644 725 gyrB DNA gyrase subunit B; Validated 98.95
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 98.86
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 98.68
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 98.64
PRK03660146 anti-sigma F factor; Provisional 97.52
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 96.23
TIGR029561052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 95.67
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 95.47
PRK04069158 serine-protein kinase RsbW; Provisional 94.01
COG3290537 CitA Signal transduction histidine kinase regulating ci 98.55
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 96.54
PRK10841947 hybrid sensory kinase in two-component regulatory syste 96.39
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 96.13
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 98.52
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 98.4
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 97.82
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 97.04
COG3920221 Signal transduction histidine kinase [Signal transducti 93.95
PRK11086541 sensory histidine kinase DcuS; Provisional 98.49
PRK11360607 sensory histidine kinase AtoS; Provisional 98.11
PRK10755355 sensor protein BasS/PmrB; Provisional 97.92
PRK10604433 sensor protein RstB; Provisional 97.85
PRK09467437 envZ osmolarity sensor protein; Provisional 97.84
PRK10815484 sensor protein PhoQ; Provisional 97.73
PRK10490895 sensor protein KdpD; Provisional 96.78
COG5000712 NtrY Signal transduction histidine kinase involved in n 96.57
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 96.53
COG4192673 Signal transduction histidine kinase regulating phospho 96.27
COG2972456 Predicted signal transduction protein with a C-terminal 95.32
COG5002459 VicK Signal transduction histidine kinase [Signal trans 95.07
pfam0274271 Fe_dep_repr_C Iron dependent repressor, metal binding a 93.37
COG4564459 Signal transduction histidine kinase [Signal transducti 90.36
COG4191603 Signal transduction histidine kinase regulating C4-dica 98.22
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 96.66
PRK10364455 sensor protein ZraS; Provisional 98.16
PRK11006431 phoR phosphate regulon sensor protein; Provisional 97.49
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 93.14
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 97.93
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 94.2
PRK09470461 cpxA two-component sensor protein; Provisional 97.92
PRK11100475 sensory histidine kinase CreC; Provisional 97.76
PRK10337446 sensor protein QseC; Provisional 97.69
PRK09835482 sensor kinase CusS; Provisional 97.64
PRK09303378 adaptive-response sensory kinase; Validated 97.42
PRK10547662 chemotaxis protein CheA; Provisional 95.88
COG0643716 CheA Chemotaxis protein histidine kinase and related ki 94.05
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 97.88
PRK13837831 two-component VirA-like sensor kinase; Provisional 97.75
PRK13557538 histidine kinase; Provisional 97.47
PRK11644497 sensory histidine kinase UhpB; Provisional 97.12
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 97.01
COG4585365 Signal transduction histidine kinase [Signal transducti 95.93
PRK13560 807 hypothetical protein; Provisional 95.49
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 95.63
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 95.57
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>KOG1977 consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>pfam08676 MutL_C MutL C terminal dimerization domain Back     alignment and domain information
>smart00853 MutL_C MutL C terminal dimerisation domain Back     alignment and domain information
>cd03482 MutL_Trans_MutL MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL Back     alignment and domain information
>cd03483 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1) Back     alignment and domain information
>cd00782 MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>pfam01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain Back     alignment and domain information
>cd03484 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2) Back     alignment and domain information
>cd03485 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2 Back     alignment and domain information
>cd03486 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH3 (MutL homologue 3) Back     alignment and domain information
>cd00329 TopoII_MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IPR005737 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>KOG0019 consensus Back     alignment and domain information
>KOG0020 consensus Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>pfam02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerization domain Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target594 DNA mismatch repair protein [Candidatus Liberibacter as
1b62_A355 Mutl Complexed With Adp Length = 355 1e-101
1bkn_A352 Crystal Structure Of An N-Terminal 40kd Fragment Of 1e-101
1b63_A333 Mutl Complexed With Adpnp Length = 333 1e-100
1nhj_A333 Crystal Structure Of N-Terminal 40kd MutlA100P MUTA 1e-100
3na3_A348 Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens 3e-83
1h7u_A365 Hpms2-Atpgs Length = 365 9e-66
1ea6_A364 N-Terminal 40kda Fragment Of Nhpms2 Complexed With 9e-66
1h7s_A365 N-Terminal 40kda Fragment Of Human Pms2 Length = 36 4e-65
3h4l_A367 Crystal Structure Of N Terminal Domain Of A Dna Rep 5e-58
3ncv_A220 Ngol Length = 220 4e-51
3gab_A197 C-Terminal Domain Of Bacillus Subtilis Mutl Crystal 1e-41
1z59_A469 Topoisomerase Vi-B, Adp-Bound Monomer Form Length = 2e-05
1z5a_A469 Topoisomerase Vi-B, Adp-Bound Dimer Form Length = 4 2e-05
2zbk_B530 Crystal Structure Of An Intact Type Ii Dna Topoisom 2e-05
1mx0_A472 Structure Of Topoisomerase Subunit Length = 472 2e-05
1mu5_A471 Structure Of Topoisomerase Subunit Length = 471 2e-05
3g75_A184 Crystal Structure Of Staphylococcus Aureus Gyrase B 0.002
1x9z_A188 Crystal Structure Of The Mutl C-Terminal Domain Len 1e-04
>gi|157838229|pdb|1B62|A Chain A, Mutl Complexed With Adp Length = 355 Back     alignment and structure
 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 128/348 (36%), Positives = 195/348 (56%), Gaps = 4/348 (1%)

Query: 1   MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNG 60
           M I+ L  ++ NQIAAGE++ERP+  +KEL+ENSLDA ++R++  I  GG    +I DNG
Sbjct: 7   MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNG 66

Query: 61  FGMTSEEIPMAVQRHCTSKIS--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTG 118
            G+  +E+ +A+ RH TSKI+  DD   I + GFRGEAL SI +VS LTL SR  +    
Sbjct: 67  CGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEA 126

Query: 119 AQIAISGEKIS-SVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAI 177
            Q    G  ++ +V+P A   GT +EV DLF+  PAR  FL++E+ E N I ++IRR+A+
Sbjct: 127 WQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIAL 186

Query: 178 AYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT 237
           A   V+   S       +       G    R+  + G  F+  A+ +  +  ++TL+G+ 
Sbjct: 187 ARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWV 246

Query: 238 GIPTFNRGN-ANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVD 296
             P       A   Y ++NGR ++D+ I   IR A  + +   + P  VL LEIDP QVD
Sbjct: 247 ADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVD 306

Query: 297 VNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKKMISS 344
           VNVHPAK  +RF    ++ +FI Q +   + ++  +   +  +   + 
Sbjct: 307 VNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAP 354


>gi|5107506|pdb|1BKN|A Chain A, Crystal Structure Of An N-Terminal 40kd Fragment Of E. Coli Dna Mismatch Repair Protein Mutl Length = 352 Back     alignment and structure
>gi|5542073|pdb|1B63|A Chain A, Mutl Complexed With Adpnp Length = 333 Back     alignment and structure
>gi|33357458|pdb|1NHJ|A Chain A, Crystal Structure Of N-Terminal 40kd MutlA100P MUTANT Protein Complex With Adpnp And One Sodium Length = 333 Back     alignment and structure
>gi|302148833|pdb|3NA3|A Chain A, Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens Length = 348 Back     alignment and structure
>gi|17942778|pdb|1H7U|A Chain A, Hpms2-Atpgs Length = 365 Back     alignment and structure
>gi|17942770|pdb|1EA6|A Chain A, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp Length = 364 Back     alignment and structure
>gi|17942780|pdb|1H7S|A Chain A, N-Terminal 40kda Fragment Of Human Pms2 Length = 365 Back     alignment and structure
>gi|290560158|pdb|3H4L|A Chain A, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367 Back     alignment and structure
>gi|313754335|pdb|3NCV|A Chain A, Ngol Length = 220 Back     alignment and structure
>gi|301015759|pdb|3GAB|A Chain A, C-Terminal Domain Of Bacillus Subtilis Mutl Crystal Form I Length = 197 Back     alignment and structure
>gi|71042167|pdb|1Z59|A Chain A, Topoisomerase Vi-B, Adp-Bound Monomer Form Length = 469 Back     alignment and structure
>gi|71042168|pdb|1Z5A|A Chain A, Topoisomerase Vi-B, Adp-Bound Dimer Form Length = 469 Back     alignment and structure
gi|167745001|pdb|2ZBK|B Chain B, Crystal Structure Of An Intact Type Ii Dna Topoisomerase: Insights Into Dna Transfer Mechanisms Length = 530 Back     alignment and structure
>gi|28373805|pdb|1MX0|A Chain A, Structure Of Topoisomerase Subunit Length = 472 Back     alignment and structure
>gi|28373795|pdb|1MU5|A Chain A, Structure Of Topoisomerase Subunit Length = 471 Back     alignment and structure
>gi|288562960|pdb|3G75|A Chain A, Crystal Structure Of Staphylococcus Aureus Gyrase B Co- Complexed With Inhibitor Length = 184 Back     alignment and structure
>gi|56554422|pdb|1X9Z|A Chain A, Crystal Structure Of The Mutl C-Terminal Domain Length = 188 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target594 DNA mismatch repair protein [Candidatus Liberibacter as
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein homolog 4e-81
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 1e-78
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 2e-77
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 1e-73
3kdg_A197 DNA mismatch repair protein MUTL; endonuclease, DNA dam 4e-51
1x9z_A188 DNA mismatch repair protein MUTL; alpha-beta fold, dime 5e-37
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 1e-18
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 1e-15
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 2e-18
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 0.004
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
 Score =  297 bits (762), Expect = 4e-81
 Identities = 110/337 (32%), Positives = 177/337 (52%), Gaps = 9/337 (2%)

Query: 2   KIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGF 61
            IR+L E ++N+IAAGE+I+RP+ AIKE+IEN LDA+S+ ++ ++  GG    QI DNG 
Sbjct: 8   VIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGT 67

Query: 62  GMTSEEIPMAVQRHCTSKI--SDDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGA 119
           G+  E++ +  +R  TSK+   +D ++I T+GFRGEAL SI  V+H+T+ ++        
Sbjct: 68  GIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAY 127

Query: 120 Q-IAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQVETNLITDVIRRMAIA 178
           +     G+  +  +P A N GT + V DLF+ I  R   LK+   E   I +V+ R ++ 
Sbjct: 128 RASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVH 187

Query: 179 YPKVSFTFSTIKSNRYKMNFQST-NGNFPERISQVIGEDFINNAVELN--EKSNEITLQG 235
              +SF+    K      + ++  N +  + I  + G       +E+   +K+    + G
Sbjct: 188 NAGISFSV--KKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNG 245

Query: 236 YTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQV 295
           Y     ++      F +FIN R V+   +   I T YA  +P   +P + L LEI P+ V
Sbjct: 246 YISNANYSVKK-CIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV 304

Query: 296 DVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGIS 332
           DVNVHP K  + F +   I   + Q I+  +     S
Sbjct: 305 DVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSS 341


>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure
>3kdg_A DNA mismatch repair protein MUTL; endonuclease, DNA damage, DNA repair, hydrolase; HET: DNA; 2.00A {Bacillus subtilis} PDB: 3gab_A* 3kdk_A* Length = 197 Back     alignment and structure
>1x9z_A DNA mismatch repair protein MUTL; alpha-beta fold, dimer, replication, signaling protein; HET: DNA MSE; 2.10A {Escherichia coli} SCOP: d.292.1.1 Length = 188 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target594 DNA mismatch repair protein [Candidatus Liberibacter as
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 100.0
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 100.0
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein homolog 100.0
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 100.0
3cwv_A369 DNA gyrase, B subunit, truncated; structural genomics, 99.38
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP- 98.77
3kdg_A197 DNA mismatch repair protein MUTL; endonuclease, DNA dam 100.0
1x9z_A188 DNA mismatch repair protein MUTL; alpha-beta fold, dime 100.0
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 99.94
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 99.88
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 99.83
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; HET: 99.12
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycle, ca 99.03
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, cytopl 99.03
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone, ATP 99.01
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, liga 98.98
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 98.96
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone comp 98.94
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1 98.92
3peh_A281 Endoplasmin homolog; structural genomics, structural ge 98.87
3ied_A272 Heat shock protein; HSP90, chaperone, structural genomi 98.84
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 98.83
1s16_A390 Topoisomerase IV subunit B; two-domain protein complexe 98.78
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 98.69
1uyl_A236 HSP 86, heat shock protein HSP 90-alpha; ATPase, chaper 98.68
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 98.65
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 3.50 99.05
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 98.96
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 98.87
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 98.6
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 98.3
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 98.1
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 98.23
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 97.99
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 97.91
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 97.86
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 97.78
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 97.61
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 97.5
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 97.47
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 97.24
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, transf 97.21
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 96.42
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, sign 94.16
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 98.21
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-sigma f 95.62
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 98.19
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 98.1
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 97.66
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 94.81
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix-turn 93.61
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, transcr 91.83
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependent reg 94.07
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=717.58  Aligned_cols=327  Identities=39%  Similarity=0.649  Sum_probs=312.0

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             96745888999985268722697899999998777269967999998098439999988899889899987502466563
Q gi|254780399|r    1 MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETVIAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKI   80 (594)
Q Consensus         1 m~I~~L~~~~~~~Iaagevi~~~~svVkELveNSlDAgAt~I~v~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~rh~TSKi   80 (594)
                      |+|++||++++++|||||||++|++|||||||||||||||+|.|.|+++|+++|+|.||||||+++||+++|+||+|||+
T Consensus         3 m~I~~L~~~~~~~i~s~~vI~~~~~~vkELveNSiDA~At~I~I~v~~~g~~~I~V~DnG~GI~~~dl~~~~~r~~TSK~   82 (333)
T 1b63_A            3 MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKI   82 (333)
T ss_dssp             SCCCCCCHHHHHHHHHHHHCSSHHHHHHHHHHHHHHTTCSEEEEEEEGGGTSEEEEEECSCCCCGGGHHHHHSTTCCSSC
T ss_pred             CCCEECCHHHHHHCCCCCEECCHHHHHHHHHHHHCCCCCCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             96357999999870886765478999999986302789898999998797659999989967687688887664105778


Q ss_pred             H--HHHHHCCCCCCCHHHHHHHHHHEEEEEEEECCCCCCCEEEEECCCC-CCCCCCCCCCCCCEEEEEHHHHHHHHHHHC
Q ss_conf             1--2441121488404899987620248999804898630155110100-000211012567578852101211254310
Q gi|254780399|r   81 S--DDFSNIHTFGFRGEALPSIGAVSHLTLMSRPPQNNTGAQIAISGEK-ISSVRPVAMNPGTIVEVRDLFFTIPARLNF  157 (594)
Q Consensus        81 ~--~dl~~i~t~GFRGEAL~sIa~vs~l~i~s~~~~~~~~~~~~~~~g~-~~~~~~~~~~~GT~V~V~~LF~N~PvRrkf  157 (594)
                      .  +|+.++.|||||||||+|||+||+++|+||+++++.||++.++++. ....+|++++.||||+|+|||||+||||||
T Consensus        83 ~~~~dl~~~~t~GFRGEAL~Si~~vs~l~I~sr~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTtV~V~~LF~n~PvRrk~  162 (333)
T 1b63_A           83 ASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKF  162 (333)
T ss_dssp             CSHHHHHTCCSSCCSSCHHHHHHTTSEEEEEEECTTCSSEEEEEEETTTTEEEEEEECCCSEEEEEEESTTTTCHHHHHT
T ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEEECCCCCCCEEECCCCCCCEEEECHHHCCCHHHHHH
T ss_conf             99788556652275507999999850854433428988449999954776444025368999689960432738577752


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             34536899999999999873189974999987983079971788104899999732166654310022442036566662
Q gi|254780399|r  158 LKSEQVETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAVELNEKSNEITLQGYT  237 (594)
Q Consensus       158 lks~~~e~~~I~~~v~~~aL~~P~V~f~l~~~~~~~~~l~~~~~~~~l~~ri~~i~G~~~~~~l~~i~~~~~~~~i~G~i  237 (594)
                      ++++..|+.++.+++++|||+||+|+|++.++++....+...++..++..++..+||..+..++.++..+...++++||+
T Consensus       163 l~~~~~e~~~i~~~l~~~Al~~p~v~f~l~~~~k~~~~~~~~~~~~~~~~~i~~v~g~~~~~~~~~~~~~~~~~~i~G~i  242 (333)
T 1b63_A          163 LRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWV  242 (333)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHCTTCEEEEEETTEEEEEECCCCTTCCTHHHHHHHHCHHHHHHEEEEEEEETTEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCEEEEECCCCCCCHHHHHHHHCCHHHHHHEEEEEECCCCCEEEEEE
T ss_conf             58848889999999987332688479999978831156633689852887776531204333124432002552253354


Q ss_pred             CCCCCCCCC-CHHHHHHHCCCHHHCHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEHHHHCCCCCCHHHHHHHCCHHHHHH
Q ss_conf             161103323-2066775152100075888999987554427999807999999606571247571111255359799999
Q gi|254780399|r  238 GIPTFNRGN-ANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRYPVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRN  316 (594)
Q Consensus       238 s~P~~~r~~-~~~q~ifVNgR~V~~~~l~~AI~~aY~~~l~~g~~P~~vL~i~i~p~~vDVNVHP~K~eVrf~de~~i~~  316 (594)
                      +.|..++.. .+.||+|||||||.++.+.+||+++|++.++.++||+|+|+|+|||+.|||||||+|+||+|+||+.|.+
T Consensus       243 s~p~~~~~~~~~~q~~fVN~R~v~~~~l~~aI~~~y~~~~~~~~~P~~vL~i~~p~~~iDvNvhP~K~eV~f~~e~~I~~  322 (333)
T 1b63_A          243 ADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHD  322 (333)
T ss_dssp             ECGGGCCTTGGGCEEEEETTEECCCHHHHHHHHHHHHHHSSSCCCCCEEEEEECCGGGEECTTSTTCCCCEETTHHHHHH
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCHHEEEEECCCCCEEEECCHHHHHH
T ss_conf             38642324346536999668511468999999999885465888808999999371426442178759899788889999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99997898875
Q gi|254780399|r  317 FIIQSIQKAIN  327 (594)
Q Consensus       317 ~i~~~i~~~L~  327 (594)
                      +|.++|.++|.
T Consensus       323 ~i~~~i~~~L~  333 (333)
T 1b63_A          323 FIYQGVLSVLQ  333 (333)
T ss_dssp             HHHHHHHHHTC
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999859



>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, ATP-binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus dk 1622} Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>3kdg_A DNA mismatch repair protein MUTL; endonuclease, DNA damage, DNA repair, hydrolase; HET: DNA; 2.00A {Bacillus subtilis} PDB: 3gab_A* 3kdk_A* Back     alignment and structure
>1x9z_A DNA mismatch repair protein MUTL; alpha-beta fold, dimer, replication, signaling protein; HET: DNA MSE; 2.10A {Escherichia coli} SCOP: d.292.1.1 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, cytoplasm, ATP-binding, phosphoprotein, stress response, nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2akp_A Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 2esa_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structural genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3g75_A DNA gyrase subunit B; antibiotic resistance, isomerase; HET: DNA B48; 2.30A {Staphylococcus aureus} PDB: 3g7b_A* Back     alignment and structure
>1uyl_A HSP 86, heat shock protein HSP 90-alpha; ATPase, chaperone, ATP-binding; 1.4A {Homo sapiens} SCOP: d.122.1.1 PDB: 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* 2vcj_A* 2wi1_A* 2wi2_A* 2wi3_A* 2wi4_A* 2wi5_A* ... Back     alignment and structure
>3g7e_A DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {Escherichia coli} PDB: 1kzn_A* 1aj6_A* Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transferase; 1.60A {Escherichia coli K12} SCOP: d.122.1.3 Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi- domains protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure