254780400

254780400

hypothetical protein CLIBASIA_01425

GeneID in NCBI database:8209385Locus tag:CLIBASIA_01425
Protein GI in NCBI database:254780400Protein Accession:YP_003064813.1
Gene range:+(301926, 302141)Protein Length:71aa
Gene description:hypothetical protein
COG prediction:[T] DnaK suppressor protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
cccccccccEEEEEccccEEEEccccEEEEEEccccccHHHcEEccHHHHcHHccHHHHHHHHHccccccc
cccccccccEEEEEccccEEEEEcccEEEEEEccccccHHHHHHccHcccHHHccHHHHHHHHHHHccccc
mynkvdeneasirykdgtfeiirpgtYVVCAitgqriplkklcywsvdrqvpyanaeasfeaekisgkipy
mynkvdeneasirykdgtfeiirpGTYVVCAITGQRIPLKKLCYWSVDRQVPYANaeasfeaekisgkipy
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
*************YKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKIS*****
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
****VDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY
MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEASFEAEKISGKIPY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target71 hypothetical protein CLIBASIA_01425 [Candidatus Liberib
31512218873 hypothetical protein CKC_02190 [Candidatus Liberibacter 1 2e-24
22782100777 hypothetical protein NGR_c04280 [Sinorhizobium fredii N 1 5e-15
22208502476 hypothetical protein Arad_1093 [Agrobacterium radiobact 1 2e-14
8635649376 hypothetical protein RHE_CH00847 [Rhizobium etli CFN 42 1 4e-14
19089055776 hypothetical protein RHECIAT_CH0000936 [Rhizobium etli 1 4e-14
20954810176 hypothetical protein Rleg2_0495 [Rhizobium leguminosaru 1 5e-14
21868254876 hypothetical protein RetlC8_27307 [Rhizobium etli CIAT 1 6e-14
21851233576 hypothetical protein Retl8_00919 [Rhizobium etli 8C-3] 1 6e-14
21866323476 hypothetical protein RetlI_29843 [Rhizobium etli IE4771 1 9e-14
24120328576 hypothetical protein Rleg_0538 [Rhizobium leguminosarum 1 1e-13
>gi|315122188|ref|YP_004062677.1| hypothetical protein CKC_02190 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 73 Back     alignment and organism information
 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (91%), Gaps = 2/71 (2%)

Query: 1  MYNKVD--ENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYWSVDRQVPYANAEA 58
          MYNK+D  ENEA I+YKDGTF++IRPGTYV+CAITGQRIPL+KLCYW+VDRQVPYA++++
Sbjct: 1  MYNKIDSNENEAVIQYKDGTFKVIRPGTYVICAITGQRIPLQKLCYWNVDRQVPYADSKS 60

Query: 59 SFEAEKISGKI 69
          S EAE+ +G I
Sbjct: 61 SLEAERRAGTI 71


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821007|ref|YP_002824977.1| hypothetical protein NGR_c04280 [Sinorhizobium fredii NGR234] Length = 77 Back     alignment and organism information
>gi|222085024|ref|YP_002543553.1| hypothetical protein Arad_1093 [Agrobacterium radiobacter K84] Length = 76 Back     alignment and organism information
>gi|86356493|ref|YP_468385.1| hypothetical protein RHE_CH00847 [Rhizobium etli CFN 42] Length = 76 Back     alignment and organism information
>gi|190890557|ref|YP_001977099.1| hypothetical protein RHECIAT_CH0000936 [Rhizobium etli CIAT 652] Length = 76 Back     alignment and organism information
>gi|209548101|ref|YP_002280018.1| hypothetical protein Rleg2_0495 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 76 Back     alignment and organism information
>gi|218682548|ref|ZP_03530149.1| hypothetical protein RetlC8_27307 [Rhizobium etli CIAT 894] Length = 76 Back     alignment and organism information
>gi|218512335|ref|ZP_03509175.1| hypothetical protein Retl8_00919 [Rhizobium etli 8C-3] Length = 76 Back     alignment and organism information
>gi|218663234|ref|ZP_03519164.1| hypothetical protein RetlI_29843 [Rhizobium etli IE4771] Length = 76 Back     alignment and organism information
>gi|241203285|ref|YP_002974381.1| hypothetical protein Rleg_0538 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 76 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target71 hypothetical protein CLIBASIA_01425 [Candidatus Liberib
pfam0986642 pfam09866, DUF2093, Uncharacterized protein conserved i 4e-14
COG390877 COG3908, COG3908, Uncharacterized protein conserved in 4e-16
>gnl|CDD|150527 pfam09866, DUF2093, Uncharacterized protein conserved in bacteria (DUF2093) Back     alignment and domain information
>gnl|CDD|33695 COG3908, COG3908, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 71 hypothetical protein CLIBASIA_01425 [Candidatus Liberib
COG390877 Uncharacterized protein conserved in bacteria [Function 99.93
pfam0986642 DUF2093 Uncharacterized protein conserved in bacteria ( 99.85
TIGR02890167 spore_yteA sporulation protein, yteA family; InterPro: 94.21
COG1734120 DksA DnaK suppressor protein [Signal transduction mecha 90.87
>COG3908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam09866 DUF2093 Uncharacterized protein conserved in bacteria (DUF2093) Back     alignment and domain information
>TIGR02890 spore_yteA sporulation protein, yteA family; InterPro: IPR014240 This entry contains predicted regulatory proteins that are found in nearly every species of the endospore-forming bacteria within the Firmicutes (low-GC Gram-positive bacteria), with the exception of Clostridium perfringens Back     alignment and domain information
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00