254780401

254780401

tetraacyldisaccharide 4'-kinase

GeneID in NCBI database:8209386Locus tag:CLIBASIA_01430
Protein GI in NCBI database:254780401Protein Accession:YP_003064814.1
Gene range:-(302138, 303154)Protein Length:338aa
Gene description:tetraacyldisaccharide 4'-kinase
COG prediction:[M] Tetraacyldisaccharide-1-P 4'-kinase
KEGG prediction:lpxK; tetraacyldisaccharide 4'-kinase (EC:2.7.1.130); K00912 tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
SEED prediction:Tetraacyldisaccharide kinase (EC 2.7.1.130)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG
ccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccEEccccccHHHHHHHHHHHHHcccEEEEEcccccccccccEEEccccccHHHHcccHHHHHccccEEEcccHHHHHHHHHHccccEEEEccccccHHHcccEEEEEEEccccccccEEEEcccccccccHHHHHccEEEEEcccHHHHHHccccccccccccccccccccccEEEEEEEccccHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHcccEEEEcHHHHHHccccccccccHHHcEEEEEEEEEcccHHHHHHHHHHHHHHcccccccccc
ccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcEEcccccccHHHHHHHHHHHHccccEEEEEcccccccccccEEEcccccHHHccccHHHHHcccccEccccHHHHHHHHHHccccEEEEccccccHHHHHHcEEEEEEccccccccccccccccccccHHHHccccEEEEcccccHHHHHccccccEEEEcccccccccccccEEEEEccccHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHccccEEEEccccEEcHHHcccccccccccEEcccccccccHHHHHHHHHHHHHHHHHccccccc
mmksplfwwkargfysffLYPISWIYSFISSKLMkrgqrlhapipvicvggfvmggtgktPTALAIAKAVIdknlkpgflsrgygrksrisfrvdlekhsaydvgdeplLLARRAVTIVTSDRKIGVQMLLQEGvdiiimddgfhsadlqadFSLIVVNShrglgnglvfpagplrvplsrqLSYVDAILYVGNKKNVISSIKNKSVYFAKlkprltfdlsgkkvlafsgiadtEKFFTTVRQLGALIEQCysfgdhahlsdKKIAYLLDQAQQKGLILVTTAKDAmrlhkrpgraeEIFAKSMVIEVDIVfenpddltNLVEMTVVSFansnkkpcg
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVidknlkpgflsrgygrksrisfrvdlekhsaydvgdepllLARRAVTivtsdrkigVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKprltfdlsgKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVsfansnkkpcg
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGnkknvissiknksvYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG
*MKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVV***********
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG
***SPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNK****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG
MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
315122187344 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte 1 1e-145
325292083348 tetraacyldisaccharide 4'-kinase [Agrobacterium sp. H13- 1 8e-82
222085023355 tetraacyldisaccharide 4'-kinase [Agrobacterium radiobac 1 2e-79
209548096357 tetraacyldisaccharide 4'-kinase [Rhizobium leguminosaru 1 7e-79
227821006346 tetraacyldisaccharide 4'-kinase [Sinorhizobium fredii N 1 2e-78
15888041348 tetraacyldisaccharide 4'-kinase [Agrobacterium tumefaci 1 3e-78
241203282347 tetraacyldisaccharide 4'-kinase [Rhizobium leguminosaru 1 3e-78
150395651346 tetraacyldisaccharide 4'-kinase [Sinorhizobium medicae 1 4e-78
15964565346 tetraacyldisaccharide 4'-kinase [Sinorhizobium meliloti 1 5e-78
307320049346 tetraacyldisaccharide 4'-kinase [Sinorhizobium meliloti 1 1e-77
>gi|315122187|ref|YP_004062676.1| tetraacyldisaccharide 4'-kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 344 Back     alignment and organism information
 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 293/333 (87%)

Query: 1   MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIPVICVGGFVMGGTGKT 60
           M+K+PLFWWK++G  S FLYPIS IY  ISS  MK GQR +APIP+ICVGGFVMGGTGKT
Sbjct: 9   MIKTPLFWWKSQGLCSLFLYPISLIYGAISSIRMKYGQRWNAPIPIICVGGFVMGGTGKT 68

Query: 61  PTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVT 120
           PTALA+A AVIDKNLKPGFLSRGYGRKS +S RVDLEKH AYDVGDEPLLLA+RA  +VT
Sbjct: 69  PTALALASAVIDKNLKPGFLSRGYGRKSTLSLRVDLEKHGAYDVGDEPLLLAQRATVVVT 128

Query: 121 SDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPLS 180
           +DRK+GV+MLLQE VDIIIMDDGFHSADL+ADFSLIVV+SHRGLGNGLVFPAGPLRVPLS
Sbjct: 129 NDRKMGVKMLLQERVDIIIMDDGFHSADLRADFSLIVVDSHRGLGNGLVFPAGPLRVPLS 188

Query: 181 RQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSGKKVLAFSGIADTEKFFTT 240
           RQL YVDAILYVG+ KN+I SIKNK +YF+KL+PRL FD S  +VLAFSGIADT+KFFTT
Sbjct: 189 RQLLYVDAILYVGDTKNIIPSIKNKLIYFSKLEPRLKFDFSKTRVLAFSGIADTKKFFTT 248

Query: 241 VRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVTTAKDAMRLHKRPGRAEEIF 300
           +++LGA+IE+ YSFGDHAHLSDKKI  +LDQAQQ  L+LVTT KDAMRL+KR G AE++ 
Sbjct: 249 IQKLGAIIEKHYSFGDHAHLSDKKIECILDQAQQDNLVLVTTEKDAMRLYKRSGIAEKLL 308

Query: 301 AKSMVIEVDIVFENPDDLTNLVEMTVVSFANSN 333
           + S+VI VD++F++P +L+++V+ T++SF N N
Sbjct: 309 SISIVIGVDMIFQDPTNLSDIVDKTILSFDNRN 341


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292083|ref|YP_004277947.1| tetraacyldisaccharide 4'-kinase [Agrobacterium sp. H13-3] Length = 348 Back     alignment and organism information
>gi|222085023|ref|YP_002543552.1| tetraacyldisaccharide 4'-kinase [Agrobacterium radiobacter K84] Length = 355 Back     alignment and organism information
>gi|209548096|ref|YP_002280013.1| tetraacyldisaccharide 4'-kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 357 Back     alignment and organism information
>gi|227821006|ref|YP_002824976.1| tetraacyldisaccharide 4'-kinase [Sinorhizobium fredii NGR234] Length = 346 Back     alignment and organism information
>gi|15888041|ref|NP_353722.1| tetraacyldisaccharide 4'-kinase [Agrobacterium tumefaciens str. C58] Length = 348 Back     alignment and organism information
>gi|241203282|ref|YP_002974378.1| tetraacyldisaccharide 4'-kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 347 Back     alignment and organism information
>gi|150395651|ref|YP_001326118.1| tetraacyldisaccharide 4'-kinase [Sinorhizobium medicae WSM419] Length = 346 Back     alignment and organism information
>gi|15964565|ref|NP_384918.1| tetraacyldisaccharide 4'-kinase [Sinorhizobium meliloti 1021] Length = 346 Back     alignment and organism information
>gi|307320049|ref|ZP_07599470.1| tetraacyldisaccharide 4'-kinase [Sinorhizobium meliloti AK83] Length = 346 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
PRK00652328 PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Review 8e-81
COG1663336 COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase [Cel 8e-77
TIGR00682311 TIGR00682, lpxK, tetraacyldisaccharide 4'-kinase 6e-52
PRK01906338 PRK01906, PRK01906, tetraacyldisaccharide 4'-kinase; Pr 3e-40
pfam02606318 pfam02606, LpxK, Tetraacyldisaccharide-1-P 4'-kinase 7e-82
>gnl|CDD|179082 PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>gnl|CDD|31849 COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|161995 TIGR00682, lpxK, tetraacyldisaccharide 4'-kinase Back     alignment and domain information
>gnl|CDD|179349 PRK01906, PRK01906, tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>gnl|CDD|145645 pfam02606, LpxK, Tetraacyldisaccharide-1-P 4'-kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 100.0
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 100.0
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 100.0
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 100.0
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 100.0
TIGR00682342 lpxK tetraacyldisaccharide 4'-kinase; InterPro: IPR0037 100.0
COG2403449 Predicted GTPase [General function prediction only] 98.56
PRK00771433 signal recognition particle protein Srp54; Provisional 96.85
KOG0780483 consensus 96.55
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 96.34
PRK10867453 signal recognition particle protein; Provisional 96.15
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 95.54
KOG0342 543 consensus 94.23
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 94.1
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 94.04
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 93.14
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 96.8
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 91.01
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.77
COG1341398 Predicted GTPase or GTP-binding protein [General functi 92.26
PRK07933213 thymidylate kinase; Validated 91.8
PRK11670369 putative ATPase; Provisional 91.61
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 96.74
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 96.63
PRK13869405 plasmid-partitioning protein RepA; Provisional 96.55
PHA02518211 ParA-like protein; Provisional 96.49
PRK13849231 putative crown gall tumor protein VirC1; Provisional 96.48
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 96.34
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 96.24
PRK13705388 plasmid-partitioning protein SopA; Provisional 96.15
PHA02519387 plasmid partition protein SopA; Reviewed 95.75
PRK08116262 hypothetical protein; Validated 95.57
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.36
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 95.31
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 94.56
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 94.51
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 94.46
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 94.45
PRK07952242 DNA replication protein DnaC; Validated 94.2
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 94.04
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 93.95
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 93.87
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 93.79
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 93.71
cd03116159 MobB Molybdenum is an essential trace element in the fo 93.34
cd02040270 NifH NifH gene encodes component II (iron protein) of n 93.15
cd02034116 CooC The accessory protein CooC, which contains a nucle 92.78
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 92.62
cd02036179 MinD Bacterial cell division requires the formation of 92.54
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 92.43
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 92.43
CHL00175279 minD septum-site determining protein; Validated 92.35
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 92.31
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 92.23
PRK10818270 cell division inhibitor MinD; Provisional 92.2
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 92.04
pfam03266168 DUF265 Protein of unknown function, DUF265. 91.87
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 90.94
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 90.7
cd02117212 NifH_like This family contains the NifH (iron protein) 90.52
PRK10037250 cell division protein; Provisional 90.34
PRK10416499 cell division protein FtsY; Provisional 96.32
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.12
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.77
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.36
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 95.08
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 94.76
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.22
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 93.34
PRK13976202 thymidylate kinase; Provisional 93.2
CHL00181287 cbbX CbbX; Provisional 92.51
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 92.22
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 91.8
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 90.94
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 94.96
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 94.39
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 94.2
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 93.68
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 93.54
KOG2743391 consensus 93.1
cd03114148 ArgK-like The function of this protein family is unkown 93.03
COG3367339 Uncharacterized conserved protein [Function unknown] 91.83
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 91.78
PRK11537317 putative GTP-binding protein YjiA; Provisional 91.3
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 91.18
COG0523323 Putative GTPases (G3E family) [General function predict 91.03
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.18
pfam03618255 DUF299 Domain of unknown function (DUF299). Family of b 90.59
PRK05339273 hypothetical protein; Provisional 90.54
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>pfam02606 LpxK Tetraacyldisaccharide-1-P 4'-kinase Back     alignment and domain information
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase 2 Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348 This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>pfam02374 ArsA_ATPase Anion-transporting ATPase Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>pfam08433 KTI12 Chromatin associated protein KTI12 Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>pfam03266 DUF265 Protein of unknown function, DUF265 Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>pfam02492 cobW CobW/HypB/UreG, nucleotide-binding domain Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>KOG2743 consensus Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>pfam03618 DUF299 Domain of unknown function (DUF299) Back     alignment and domain information
>PRK05339 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis protein 97.29
2qy9_A309 Cell division protein FTSY; SRP receptor, protein targe 96.3
1j8m_F297 SRP54, signal recognition 54 kDa protein; signaling pro 96.26
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 96.21
2og2_A359 Putative signal recognition particle receptor; nucleoti 96.07
3e70_C328 DPA, signal recognition particle receptor; FTSY, SRP-GT 95.91
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, recepto 95.71
1vma_A306 Cell division protein FTSY; TM0570, structural genomics 95.67
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CPFTSY; 95.56
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 95.12
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domain, he 95.01
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, flagel 94.57
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 94.49
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein-RNA, 96.55
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal recogn 96.54
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, GTPa 96.27
2j37_W504 Signal recognition particle 54 kDa protein (SRP54); rib 96.11
2j28_9430 Signal recognition particle 54; ribosome, protein/RNA c 94.22
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, SF2 AT 92.84
1xjc_A169 MOBB protein homolog; structural genomics, midwest cent 96.22
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-alpha 95.41
2oze_A298 ORF delta'; para, walker type atpases, DNA segregation, 95.26
3cwq_A209 Para family chromosome partitioning protein; alpha-beta 95.17
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 95.15
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, wing 95.08
3fkq_A373 NTRC-like two-domain protein; RER070207001320, structur 94.85
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPase, Zn 94.67
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynthetic 94.62
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bac 94.56
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targeting 94.51
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, structu 94.3
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, ADP, 94.18
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, accessory 94.14
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iron-sul 94.14
3end_A307 Light-independent protochlorophyllide reductase iron-su 93.65
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.93A {C 93.49
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, UW, 93.43
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: 93.26
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chromosome 92.97
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targeting 92.93
3igf_A374 ALL4481 protein; two-domained protein consisting of the 92.87
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and beta pr 92.8
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia coli 92.54
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucleotid 92.02
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, ADP, 91.93
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine 90.88
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, structu 90.79
1ls1_A295 Signal recognition particle protein; FFH, SRP54, SRP, G 96.07
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleotide-bi 95.49
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, membrane 94.65
1yks_A 440 Genome polyprotein [contains: flavivirin protease NS3 c 93.77
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural geno 93.48
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, RNA r 92.44
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene 91.74
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, flavivirin 91.7
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucleotide 93.83
2www_A349 Methylmalonic aciduria type A protein, mitochondrial; t 93.65
1nij_A318 Hypothetical protein YJIA; structural genomics, P-loop 93.41
2p67_A341 LAO/AO transport system kinase; ARGK, structural genomi 91.83
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone; HET: M 90.98
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics, sea 90.71
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
Probab=97.29  E-value=0.00073  Score=46.56  Aligned_cols=105  Identities=20%  Similarity=0.458  Sum_probs=62.7

Q ss_pred             CCEEEECCEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEEC---CCCCHHHHCCHHHHHHHCCC-CCC
Q ss_conf             98899823000788874899999999852473159876045787777558714---56788770421233220576-346
Q gi|254780401|r   44 IPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDL---EKHSAYDVGDEPLLLARRAV-TIV  119 (338)
Q Consensus        44 ~pVI~VGNitvGGtGKTP~v~~l~~~l~~~g~~~~ilsRGYg~~~~~~~~v~~---~~~~~~~vGDEp~lla~~~p-v~V  119 (338)
                      +|||+|--  .-|||||.++..|+..|+++|++|+++-....+     +.++.   +..--.++|....+++...- ..+
T Consensus         6 ~pii~ivG--~~~SGKTTLi~~li~~L~~~G~~V~~IKh~~h~-----~~~D~~gkDs~r~~~aGA~~v~~~s~~~~a~~   78 (174)
T 1np6_A            6 IPLLAFAA--WSGTGKTTLLKKLIPALCARGIRPGLIKHTHHD-----MDVDKPGKDSYELRKAGAAQTIVASQQRWALM   78 (174)
T ss_dssp             CCEEEEEC--CTTSCHHHHHHHHHHHHHHTTCCEEEEEECCC-----------------CHHHHTCSEEEEECSSEEEEE
T ss_pred             EEEEEEEC--CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC-----CCCCCCCCCCHHHHHCCCCEEEEECCCEEEEE
T ss_conf             02799990--699989999999999999779828899745887-----67888997079999648707999628969999


Q ss_pred             CCCH---HHHHHHHC----CCCCCEEEECCCCCCCCCCCEEEEEEEC
Q ss_conf             5201---22566410----2457479971832234412306999961
Q gi|254780401|r  120 TSDR---KIGVQMLL----QEGVDIIIMDDGFHSADLQADFSLIVVN  159 (338)
Q Consensus       120 ~~~R---~~~~~~~~----~~~~diiIlDDGfQh~~l~rdl~Ivl~d  159 (338)
                      .+.+   ....+.+.    ..++|+||.. ||-|-.+.|   |+|+.
T Consensus        79 ~~~~~~~~~~l~~l~~~~~~~~~DlvlvE-GfK~~~~PK---IeV~R  121 (174)
T 1np6_A           79 TETPDEEELDLQFLASRMDTSKLDLILVE-GFKHEEIAK---IVLFR  121 (174)
T ss_dssp             EECSSSCCCCHHHHHHHSCGGGCSEEEEE-SCSSCCSEE---EEEEC
T ss_pred             ECCCCCCCCCHHHHHHHCCCCCCCEEEEC-CCCCCCCCE---EEEEC
T ss_conf             72688678899999975155666689973-446678876---99975



>2qy9_A Cell division protein FTSY; SRP receptor, protein targeting, simibi class GTPase, cell cycle, GTP-binding, inner membrane, membrane; 1.90A {Escherichia coli} SCOP: a.24.13.1 c.37.1.10 PDB: 1fts_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein-protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus P2} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2j28_9 Signal recognition particle 54; ribosome, protein/RNA complex; 8.0A {Escherichia coli} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthase; TM0166, structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, P partition, DNA binding protein; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydrolase; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide, SAD phasing; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta fold and the C-terminal all beta domain., structural genomics, PSI-2; 2.00A {Nostoc SP} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, hydrolase; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, ATP-binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus VF5} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydrolase; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: ATP; 2.20A {Chlorobium tepidum tls} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural genomics consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, cytoplasm, nucleus, phosphoprotein, RNA-binding, ATP-binding; 3.50A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, flavivirin protease NS3 catalytic subunit...; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, disease mutation, mitochondrion, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure 2 function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural genomics, PSI-2, protein structure initiative; 1.80A {Escherichia coli K12} SCOP: c.37.1.10 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone; HET: MSE; 1.70A {Methylobacterium extorquens AM1} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 3nxs_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Escherich 96.71
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens [Tax 91.19
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia coli [ 90.64
d1j8yf2211 GTPase domain of the signal sequence recognition protei 96.29
d2qy9a2211 GTPase domain of the signal recognition particle recept 95.52
d1vmaa2213 GTPase domain of the signal recognition particle recept 95.39
d1okkd2207 GTPase domain of the signal recognition particle recept 95.32
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei [Tax 94.42
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima [Tax 94.29
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 2336] 93.05
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escherichia 92.55
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis protein 95.78
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis protein 95.68
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia coli [T 95.12
d1ls1a2207 GTPase domain of the signal sequence recognition protei 95.02
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus furio 94.89
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum [Tax 94.44
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia coli [T 94.27
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [TaxId 93.83
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} 92.69
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglobus fu 92.45
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 10 91.52
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [Ta 90.09
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=96.71  E-value=0.00019  Score=48.95  Aligned_cols=137  Identities=20%  Similarity=0.238  Sum_probs=71.8

Q ss_pred             CCCEEEECCEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEECCCCCHHHHCCHHHHHHHCCCCCCCCC
Q ss_conf             89889982300078887489999999985247315987604578777755871456788770421233220576346520
Q gi|254780401|r   43 PIPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDVGDEPLLLARRAVTIVTSD  122 (338)
Q Consensus        43 ~~pVI~VGNitvGGtGKTP~v~~l~~~l~~~g~~~~ilsRGYg~~~~~~~~v~~~~~~~~~vGDEp~lla~~~pv~V~~~  122 (338)
                      |+||..|+-.-  |+|||.+...+.+.  ..|.+++||.--+|...     ++....  ...+++...+...|--+....
T Consensus         2 ~iPv~iitGFL--GaGKTTll~~lL~~--~~~~riaVI~Ne~g~~~-----iD~~~~--~~~~~~~~el~~gcicc~~~~   70 (222)
T d1nija1           2 PIAVTLLTGFL--GAGKTTLLRHILNE--QHGYKIAVIENEFGEVS-----VDDQLI--GDRATQIKTLTNGCICCSRSN   70 (222)
T ss_dssp             CEEEEEEEESS--SSSCHHHHHHHHHS--CCCCCEEEECSSCCSCC-----EEEEEE--CTTSCEEEEETTSCEEECTTS
T ss_pred             CCCEEEEEECC--CCCHHHHHHHHHHC--CCCCCEEEEEECCCCHH-----HHHHHH--CCCCCCEEEECCCCCEECCCH
T ss_conf             97889986488--89999999999856--78983799973664112-----233430--256652488438840000003


Q ss_pred             H-HHHHHHH-C-----CCCCCEEEE----------------CCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCHHHHHCC
Q ss_conf             1-2256641-0-----245747997----------------183223441230699996184335665537613652100
Q gi|254780401|r  123 R-KIGVQML-L-----QEGVDIIIM----------------DDGFHSADLQADFSLIVVNSHRGLGNGLVFPAGPLRVPL  179 (338)
Q Consensus       123 R-~~~~~~~-~-----~~~~diiIl----------------DDGfQh~~l~rdl~Ivl~d~~~~~gn~~llPaGpLREp~  179 (338)
                      - ..+...+ .     ...+|.|+.                .|........-+--|+++|+.++...-.-.   ++   .
T Consensus        71 ~~~~~l~~~~~~~~~~~~~~d~iiIE~sG~~~p~~l~~~~~~~~~~~~~~~l~~vi~vVDa~~~~~~~~~~---~~---~  144 (222)
T d1nija1          71 ELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQF---TI---A  144 (222)
T ss_dssp             CHHHHHHHHHHHHHHTSCCCSEEEEEEETTCCHHHHHHHHHHSHHHHHHEEEEEEEEEEETTTHHHHHHHC---HH---H
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH---HH---H
T ss_conf             67777889999986046776536786224210468999988520144421113402133355444443346---78---9


Q ss_pred             HHHHHHHHHHHHCCCCH
Q ss_conf             25566514544204412
Q gi|254780401|r  180 SRQLSYVDAILYVGNKK  196 (338)
Q Consensus       180 ~~~l~rad~vi~~~~~~  196 (338)
                      ...+..||++++||.+.
T Consensus       145 ~~Qi~~AD~ivlNK~Dl  161 (222)
T d1nija1         145 QSQVGYADRILLTKTDV  161 (222)
T ss_dssp             HHHHHTCSEEEEECTTT
T ss_pred             HHHHHHCCCCCCCCCCC
T ss_conf             99998688302446455



>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 338 tetraacyldisaccharide 4'-kinase [Candidatus Liberi
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 0.003

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target338 tetraacyldisaccharide 4'-kinase [Candidatus Liberibacte
1xjc_A_169 MOBB protein homolog; structural genomics, midwest 96.66
1np6_A_174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.96
1ihu_A_1-303303 Arsenical pump-driving ATPase; aluminum fluoride, 95.67
1hyq_A_263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 95.28
3c8u_A_1-61_124-208146 Fructokinase; YP_612366.1, putative fructose trans 95.18
3fgn_A_251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 95.02
3cwq_A_209 Para family chromosome partitioning protein; alpha 94.98
2f1r_A_1-44_95-171121 Molybdopterin-guanine dinucleotide biosynthesis pr 94.8
1odf_A_1-73_153-290211 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.77
2oze_A_298 ORF delta'; para, walker type atpases, DNA segrega 94.76
2npi_A_118-328211 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 94.69
2ph1_A_1-228228 Nucleotide-binding protein; alpha-beta protein, st 94.58
1j8m_F_92-284193 SRP54, signal recognition 54 kDa protein; signalin 94.57
3iqw_A_334 Tail-anchored protein targeting factor GET3; ATPas 94.53
2woo_A_329 ATPase GET3; tail-anchored, membrane protein, targ 94.47
1cp2_A_269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 94.4
3e1s_A_150-344_555-574215 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.36
2qmo_A_220 Dethiobiotin synthetase; structural genomics, PSI- 94.29
1wcv_1_257 SOJ, segregation protein; ATPase, bacterial, chrom 94.28
2afh_E_289 Nitrogenase iron protein 1; nitrogen fixation, iro 94.27
3end_A_307 Light-independent protochlorophyllide reductase ir 94.26
1byi_A_224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 94.21
1g3q_A_237 MIND ATPase, cell division inhibitor; alpha-beta-a 94.2
1ihu_A_304-589286 Arsenical pump-driving ATPase; aluminum fluoride, 94.13
1a7j_A_290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.05
3fkq_A_139-373235 NTRC-like two-domain protein; RER070207001320, str 94.03
3kjh_A_254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.89
3igf_A_1-297297 ALL4481 protein; two-domained protein consisting o 93.82
3ea0_A_245 ATPase, para family; alpha-beta-alpha sandwich, st 93.53
2g0t_A_160-350191 Conserved hypothetical protein; TM0796, structural 93.3
3ez2_A_103-398296 Plasmid partition protein A; type IA, DNA binding, 92.98
3ez9_A_106-403298 Para; DNA binding, winged-HTH, partition, biosynth 92.83
3cio_A_299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 92.82
2woj_A_354 ATPase GET3; tail-anchored, membrane protein, targ 92.45
1bif_A_1-231231 6-phosphofructo-2-kinase/ fructose-2,6- bisphospha 92.35
2axn_A_27-244218 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.31
2j9r_A_1-167167 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.29
3io3_A_348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 91.69
1zu4_A_97-299203 FTSY; GTPase, signal recognition particle, SRP, re 91.55
3k9g_A_267 PF-32 protein; ssgcid, SBRI, decode biostructures, 91.52
2b8t_A_1-155155 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.88
3bfv_A_271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 90.68
3bos_A_1-175175 Putative DNA replication factor; YP_927791.1, puta 90.4
2www_A_1-262262 Methylmalonic aciduria type A protein, mitochondri 96.25
1yrb_A_262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.56
1nij_A_1-204204 Hypothetical protein YJIA; structural genomics, P- 95.31
1w78_A_1-286286 FOLC bifunctional protein; DHFS, dihydrofolate syn 93.37
2px0_A_99-285187 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.03
1vma_A_306 Cell division protein FTSY; TM0570, structural gen 95.51
1qzx_A_98-290193 SRP54, signal recognition 54 kDa protein; signal r 94.9
>1xjc_A (A:) MOBB protein homolog; structural genomics, midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=96.66  E-value=0.0057  Score=41.27  Aligned_cols=43  Identities=19%  Similarity=0.118  Sum_probs=34.7

Q ss_pred             CCEEEECCEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             988998230007888748999999998524731598760457877
Q gi|254780401|r   44 IPVICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKS   88 (338)
Q Consensus        44 ~pVI~VGNitvGGtGKTP~v~~l~~~l~~~g~~~~ilsRGYg~~~   88 (338)
                      .|||++.-  .+|+|||-+...|+..|+++|++|+++.-..++..
T Consensus         4 ~~vi~i~G--~~GsGKTTll~~l~~~l~~~g~kV~vi~~D~~~~~   46 (169)
T 1xjc_A            4 XNVWQVVG--YKHSGKTTLXEKWVAAAVREGWRVGTVKHHGHGGE   46 (169)
T ss_dssp             CCEEEEEC--CTTSSHHHHHHHHHHHHHHTTCCEEEEECCC----
T ss_pred             CEEEEEEC--CCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             65999982--99998999999999999866995157525775654



>1np6_A (A:) Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} Back     alignment and structure
>1ihu_A (A:1-303) Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydrolase; HET: ADP; 2.15A {Escherichia coli} Back     alignment and structure
>1hyq_A (A:) MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} Back     alignment and structure
>3c8u_A (A:1-61,A:124-208) Fructokinase; YP_612366.1, putative fructose transport system kinase, structural genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3fgn_A (A:) Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP- binding, ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>3cwq_A (A:) Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2f1r_A (A:1-44,A:95-171) Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1odf_A (A:1-73,A:153-290) YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2oze_A (A:) ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2npi_A (A:118-328) Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcription; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ph1_A (A:1-228) Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>1j8m_F (F:92-284) SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} Back     alignment and structure
>3iqw_A (A:) Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2woo_A (A:) ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1cp2_A (A:) CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} Back     alignment and structure
>3e1s_A (A:150-344,A:555-574) Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, hydrolase; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2qmo_A (A:) Dethiobiotin synthetase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.47A {Helicobacter pylori 26695} Back     alignment and structure
>1wcv_1 (1:) SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Ther