254780402

254780402

3-deoxy-D-manno-octulosonic-acid transferase

GeneID in NCBI database:8209387Locus tag:CLIBASIA_01435
Protein GI in NCBI database:254780402Protein Accession:YP_003064815.1
Gene range:-(303210, 304532)Protein Length:440aa
Gene description:3-deoxy-D-manno-octulosonic-acid transferase
COG prediction:[M] 3-deoxy-D-manno-octulosonic-acid transferase
KEGG prediction:kdtA; 3-deoxy-D-manno-octulosonic-acid transferase; K02527 3-deoxy-D-manno-octulosonic-acid transferase [EC:2.-.-.-]
SEED prediction:3-deoxy-D-manno-octulosonic-acid transferase (EC 2.-.-.-)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHcccccEEEccccccccccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEEccccccccccEEEEEcHHHHHHHHHHccEEEEcccccccccccHHHHHHccccEEEccccccHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHccccEEEEEccEEcccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEccHHHHHHHHHHHcEEEEcccccccccccccHHHHccccEEEccccccHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccc
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRErgrkfgerlgyptalrpigpliwfhassvgeTMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAihqyapldiqPAVSRFLKywkpdcmilsesdiwpltvFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIvsgnlkidteslpcdKELLSLYQESIAGRYTWAAIstfegeedkAVYVHNFIKCRTDVltiivprhprrcDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGrsfcasggqnpLEAAMLGCailsgpnvenFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLdsyvnplifqnhllskdpsfkq
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVnarmsrrsfkNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELgaqklivsgnlkidteslPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCrtdvltiivprhprrcdaIERRLIAKglkvarrsrgdvinaevdiflgdtIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIfqnhllskdpsfkq
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ
****LDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNP****************
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ
**NVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKD*****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ
MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
315122186440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu 1 0.0
86356490439 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium 1 1e-132
209548094439 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium 1 1e-130
116250676439 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium 1 1e-130
327192203439 3-deoxy-D-manno-octulosonic acid transferase protein [R 1 1e-130
190890553439 3-deoxy-D-manno-octulosonic acid transferase [Rhizobium 1 1e-130
218682629435 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium 1 1e-130
307314753437 Three-deoxy-D-manno-octulosonic-acid transferase domain 1 1e-130
15964563437 3-deoxy-D-manno-octulosonic-acid transferase [Sinorhizo 1 1e-129
241203280439 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium 1 1e-129
>gi|315122186|ref|YP_004062675.1| 3-deoxy-D-manno-octulosonic-acid transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 440 Back     alignment and organism information
 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/435 (71%), Positives = 368/435 (84%)

Query: 1   MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGERLGYPTALRPIGPLIW 60
           M  ++  IL GIYRWGGI  MPFLS  L   ++F++E+     E+LGYP++ RP+GPLIW
Sbjct: 1   MDVIVSYILFGIYRWGGILLMPFLSFYLHFQKLFDKEKATIGIEKLGYPSSFRPMGPLIW 60

Query: 61  FHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQPAV 120
           FHA SVGET+ALIGLI AIR+R++NVLLTT T TSA+VARKYLGQ  IHQYAP DIQP +
Sbjct: 61  FHAVSVGETIALIGLIRAIRNRNINVLLTTRTLTSARVARKYLGQEVIHQYAPFDIQPVL 120

Query: 121 SRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIF 180
            RFLKYW PD  ILSES+IWPLTVFELSK+RIPQ++VNARMS RSF+NW+ +  FSKKIF
Sbjct: 121 LRFLKYWHPDYFILSESEIWPLTVFELSKKRIPQIIVNARMSDRSFRNWRILPYFSKKIF 180

Query: 181 SQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAA 240
           SQFSLV+VQSE  F  YKELG +KL+VSGNLK+D   LPCD +LLS+YQ+ IAGR TWAA
Sbjct: 181 SQFSLVVVQSESDFIHYKELGTKKLVVSGNLKVDIVPLPCDDKLLSVYQKEIAGRCTWAA 240

Query: 241 ISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIAKGLKVARRSRGDVIN 300
           ISTFEGEED AVYVHN I+ R D+LTI+VPRHP RC+AIERRL++KGLKVAR +R D ++
Sbjct: 241 ISTFEGEEDAAVYVHNLIRSRQDILTILVPRHPERCNAIERRLVSKGLKVARHTRRDALS 300

Query: 301 AEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDI 360
           A+VDIFLGDTIGEMG YLRMTEIAF+GRS  ++GGQNPLE AMLGCAILSGPNVENFR+I
Sbjct: 301 ADVDIFLGDTIGEMGLYLRMTEIAFVGRSLSSNGGQNPLEPAMLGCAILSGPNVENFRNI 360

Query: 361 YRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDS 420
           Y++MVSSGAVRI+E+V  LA MV+SLLS+PT+R EMIN A+NEVKKMQGPLKITL +LD 
Sbjct: 361 YQKMVSSGAVRIIEDVEKLASMVHSLLSDPTMRDEMINTAMNEVKKMQGPLKITLCALDP 420

Query: 421 YVNPLIFQNHLLSKD 435
           Y++ L+ Q HLLS++
Sbjct: 421 YISSLVLQPHLLSQE 435


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356490|ref|YP_468382.1| 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium etli CFN 42] Length = 439 Back     alignment and organism information
>gi|209548094|ref|YP_002280011.1| 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 439 Back     alignment and organism information
>gi|116250676|ref|YP_766514.1| 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 439 Back     alignment and organism information
>gi|327192203|gb|EGE59173.1| 3-deoxy-D-manno-octulosonic acid transferase protein [Rhizobium etli CNPAF512] Length = 439 Back     alignment and organism information
>gi|190890553|ref|YP_001977095.1| 3-deoxy-D-manno-octulosonic acid transferase [Rhizobium etli CIAT 652] Length = 439 Back     alignment and organism information
>gi|218682629|ref|ZP_03530230.1| 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium etli CIAT 894] Length = 435 Back     alignment and organism information
>gi|307314753|ref|ZP_07594349.1| Three-deoxy-D-manno-octulosonic-acid transferase domain protein [Sinorhizobium meliloti BL225C] Length = 437 Back     alignment and organism information
>gi|15964563|ref|NP_384916.1| 3-deoxy-D-manno-octulosonic-acid transferase [Sinorhizobium meliloti 1021] Length = 437 Back     alignment and organism information
>gi|241203280|ref|YP_002974376.1| 3-deoxy-D-manno-octulosonic-acid transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 439 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
PRK05749425 PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-acid tr 1e-130
COG1519419 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transfe 1e-114
pfam04413186 pfam04413, Glycos_transf_N, 3-Deoxy-D-manno-octulosonic 5e-54
>gnl|CDD|180233 PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>gnl|CDD|31708 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|146849 pfam04413, Glycos_transf_N, 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
PRK05749423 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed 100.0
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell 100.0
pfam04413186 Glycos_transf_N 3-Deoxy-D-manno-octulosonic-acid transf 100.0
pfam08660166 Alg14 Oligosaccharide biosynthesis protein Alg14 like. 94.45
cd03817374 GT1_UGDG_like This family is most closely related to th 99.88
cd03814364 GT1_like_2 This family is most closely related to the G 99.87
PRK10307415 predicted glycosyl transferase; Provisional 99.87
cd03796398 GT1_PIG-A_like This family is most closely related to t 99.87
cd03801374 GT1_YqgM_like This family is most closely related to th 99.86
cd03807365 GT1_WbnK_like This family is most closely related to th 99.86
cd03820348 GT1_amsD_like This family is most closely related to th 99.85
cd03811353 GT1_WabH_like This family is most closely related to th 99.85
cd03795357 GT1_like_4 This family is most closely related to the G 99.85
cd03794394 GT1_wbuB_like This family is most closely related to th 99.84
cd03808359 GT1_cap1E_like This family is most closely related to t 99.84
cd04962371 GT1_like_5 This family is most closely related to the G 99.83
cd03798377 GT1_wlbH_like This family is most closely related to th 99.83
cd03800398 GT1_Sucrose_synthase This family is most closely relate 99.83
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltransfera 99.82
cd03822366 GT1_ecORF704_like This family is most closely related t 99.81
cd03812358 GT1_CapH_like This family is most closely related to th 99.8
cd03809365 GT1_mtfB_like This family is most closely related to th 99.8
PRK13609388 diacylglycerol glucosyltransferase; Provisional 99.8
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol 99.8
cd03819355 GT1_WavL_like This family is most closely related to th 99.79
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system associat 99.79
cd03821375 GT1_Bme6_like This family is most closely related to th 99.79
cd03805392 GT1_ALG2_like This family is most closely related to th 99.78
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.77
cd03823359 GT1_ExpE7_like This family is most closely related to t 99.77
cd04951360 GT1_WbdM_like This family is most closely related to th 99.77
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 99.71
cd03825365 GT1_wcfI_like This family is most closely related to th 99.71
cd04955363 GT1_like_6 This family is most closely related to the G 99.7
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP 99.65
PRK09922361 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-gala 99.61
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 99.58
TIGR03492396 conserved hypothetical protein. This protein family is 99.57
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 99.55
PRK00025382 lpxB lipid-A-disaccharide synthase; Reviewed 99.5
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 99.38
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope 99.36
pfam04007335 DUF354 Protein of unknown function (DUF354). Members of 99.32
pfam02684373 LpxB Lipid-A-disaccharide synthetase. This is a family 99.31
cd03802335 GT1_AviGT4_like This family is most closely related to 99.25
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-h 99.23
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP 99.1
TIGR01133368 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.07
PRK01021607 lpxB lipid-A-disaccharide synthase; Reviewed 98.86
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelope bio 98.8
TIGR02472445 sucr_P_syn_N sucrose-phosphate synthase, putative, glyc 98.71
COG1817346 Uncharacterized protein conserved in archaea [Function 98.5
COG4641373 Uncharacterized protein conserved in bacteria [Function 97.88
COG2327385 WcaK Polysaccharide pyruvyl transferase family protein 97.72
TIGR00236380 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR 97.24
COG3980318 spsG Spore coat polysaccharide biosynthesis protein, pr 95.97
COG3914620 Spy Predicted O-linked N-acetylglucosamine transferase, 94.14
COG4370412 Uncharacterized protein conserved in bacteria [Function 92.44
TIGR02470790 sucr_synth sucrose synthase; InterPro: IPR012820 This e 91.49
cd05844367 GT1_like_7 Glycosyltransferases catalyze the transfer o 99.83
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system associat 99.71
cd04949372 GT1_gtfA_like This family is most closely related to th 99.63
TIGR02149416 glgA_Coryne glycogen synthase, Corynebacterium family; 99.48
pfam02350346 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This f 99.14
PRK10125405 predicted glycosyl transferase; Provisional 98.93
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is most cl 98.81
PRK10017426 putative pyruvyl transferase; Provisional 98.74
PRK00654476 glgA glycogen synthase; Provisional 98.32
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis, out 98.1
KOG1387465 consensus 97.8
PRK09814337 hypothetical protein; Provisional 96.92
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glyco 96.85
PRK10117474 trehalose-6-phosphate synthase; Provisional 96.58
TIGR02400476 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase 95.02
pfam00982470 Glyco_transf_20 Glycosyltransferase family 20. Members 94.38
cd03818396 GT1_ExpC_like This family is most closely related to th 99.61
cd04946407 GT1_AmsK_like This family is most closely related to th 99.47
cd03804351 GT1_wbaZ_like This family is most closely related to th 99.06
cd03806419 GT1_ALG11_like This family is most closely related to t 98.93
cd03816415 GT1_ALG1_like This family is most closely related to th 98.19
KOG0853495 consensus 98.0
COG1887388 TagB Putative glycosyl/glycerophosphate transferases in 97.49
KOG2941444 consensus 96.74
pfam06258308 DUF1022 Protein of unknown function (DUF1022). This fam 96.53
PHA01630333 putative group 1 glycosyl transferase 95.62
cd03813475 GT1_like_3 This family is most closely related to the G 99.57
cd04950373 GT1_like_1 Glycosyltransferases catalyze the transfer o 97.81
cd03784401 GT1_Gtf_like This family includes the Gtfs, a group of 99.09
pfam04101167 Glyco_tran_28_C Glycosyltransferase family 28 C-termina 98.3
TIGR01426429 MGT glycosyltransferase, MGT family; InterPro: IPR00632 97.44
COG1819406 Glycosyl transferases, related to UDP-glucuronosyltrans 97.39
KOG1192496 consensus 95.31
pfam00534172 Glycos_transf_1 Glycosyl transferases group 1. Mutation 99.08
TIGR02468 1072 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR 98.16
pfam04464186 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glyc 97.51
TIGR02095517 glgA glycogen/starch synthases, ADP-glucose type; Inter 94.44
PRK00742345 chemotaxis-specific methylesterase; Provisional 92.85
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase CsaB. T 98.76
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 98.65
KOG1111426 consensus 98.34
pfam04230258 PS_pyruv_trans Polysaccharide pyruvyl transferase. Pyru 97.99
PRK10422352 lipopolysaccharide core biosynthesis protein; Provision 97.96
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases catal 97.75
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisional 97.75
COG0859334 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope 97.32
pfam00201501 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase. 97.95
PRK10964322 ADP-heptose:LPS heptosyl transferase I; Provisional 97.93
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyl 95.42
pfam06925169 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase 94.51
PHA01633335 putative glycosyl transferase group 1 91.51
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04413 Glycos_transf_N 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) Back     alignment and domain information
>pfam08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK12446 N-acetylglucosaminyl transferase; Reviewed Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information
>pfam02684 LpxB Lipid-A-disaccharide synthetase Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; InterPro: IPR006009 The murG gene of Escherichia coli encodes the N-acetylglucosaminyltransferase, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, responsible for the final step in the formation of the lipid-linked disaccharide-pentapeptide subunit of peptidoglycan Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain; InterPro: IPR012822 This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS) Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase; InterPro: IPR012820 This entry represents sucrose synthase an enzyme that despite its name, generally uses rather produces sucrose Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family; InterPro: IPR011875 This entry describes Corynebacterium glutamicum GlgA and closely related proteins in other species Back     alignment and domain information
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>PRK10125 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10017 putative pyruvyl transferase; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1387 consensus Back     alignment and domain information
>PRK09814 hypothetical protein; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]; InterPro: IPR012766 This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life Back     alignment and domain information
>pfam00982 Glyco_transf_20 Glycosyltransferase family 20 Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0853 consensus Back     alignment and domain information
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2941 consensus Back     alignment and domain information
>pfam06258 DUF1022 Protein of unknown function (DUF1022) Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>pfam04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326 These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>KOG1192 consensus Back     alignment and domain information
>pfam00534 Glycos_transf_1 Glycosyl transferases group 1 Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819 Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound Back     alignment and domain information
>pfam04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type; InterPro: IPR011835 This family consists of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>KOG1111 consensus Back     alignment and domain information
>pfam04230 PS_pyruv_trans Polysaccharide pyruvyl transferase Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>pfam06925 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
2xci_A374 Membrane-Embedded Monofunctional Glycosyltransferas 2e-25
2x6q_A416 Crystal Structure Of Trehalose Synthase Tret From P 0.002
2xmp_A416 Crystal Structure Of Trehalose Synthase Tret Mutant 0.003
>gi|332639405|pdb|2XCI|A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form Length = 374 Back     alignment and structure
 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 72/350 (20%), Positives = 129/350 (36%), Gaps = 27/350 (7%)

Query: 45  RLGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLG 104
           R     +L+     +W H +S+GE    + ++  ++  H  +LLT  +  + +  +    
Sbjct: 29  RFFPKESLKNCKGALWVHTASIGEFNTFLPILKELKREH-RILLTYFSPRAREYLKTKSD 87

Query: 105 QYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRR 164
            Y      PLD   +V RF +  KP  +I+ E + WP  +      +I            
Sbjct: 88  FYDCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPSLIIFTKVPKILV---------- 137

Query: 165 SFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDKEL 224
               +       K +  +F L+I++++    ++K  GA+++   GNLK   +        
Sbjct: 138 --NAYAKGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKRVFSCGNLKFICQKGKGI--- 192

Query: 225 LSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLI 284
                  + G +  A        E          K  + +  I+VPRH       E++  
Sbjct: 193 ------KLKGEFIVAGSIHTGEVEIILKAFKEIKKTYSSLKLILVPRHIENAKIFEKKAR 246

Query: 285 AKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAML 344
             G K +     +      D+ L D  G +     + +IA +G +F   GG N LE    
Sbjct: 247 DFGFKTSFFENLE-----GDVILVDRFGILKELYPVGKIAIVGGTFVNIGGHNLLEPTCW 301

Query: 345 GCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRY 394
           G  ++ GP      D+   +   GA   V+    L   +  LLS      
Sbjct: 302 GIPVIYGPYTHKVNDLKEFLEKEGAGFEVKNETELVTKLTELLSVKKEIK 351


>gi|308387708|pdb|2X6Q|A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshi Length = 416 Back     alignment and structure
>gi|308387756|pdb|2XMP|A Chain A, Crystal Structure Of Trehalose Synthase Tret Mutant E326a From P.Horishiki In Complex With Udp Length = 416 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino monom 2e-06
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394 Back     alignment and structure
 Score = 48.6 bits (115), Expect = 2e-06
 Identities = 49/353 (13%), Positives = 99/353 (28%), Gaps = 34/353 (9%)

Query: 72  LIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYAPLDIQP------AVSRFLK 125
           L   I       + V  +T  A  A    K L  Y + ++    + P      A++  ++
Sbjct: 25  LRDFIATQDPESIVVFASTQNAEEAHAYDKTLD-YEVIRWPRSVMLPTPTTAHAMAEIIR 83

Query: 126 YWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSL 185
             + D +    +    L      +    +V+ +       +          +KI ++  +
Sbjct: 84  EREIDNVWFGAAAPLALMAGTAKQAGASKVIASTHGHEVGWSMLPGSRQSLRKIGTEVDV 143

Query: 186 VIVQSERYFRRYKELG--AQKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWAAIST 243
           +   S+   RR+K             +  +D +                  +        
Sbjct: 144 LTYISQYTLRRFKSAFGSHPTFEHLPS-GVDVKRFTPATP---------EDKSATRKKLG 193

Query: 244 FEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIA-KGLKVARRSRGDVINAE 302
           F             +  +     I             + LI   G   +   R     ++
Sbjct: 194 FTDTTPVIACNSRLVPRKGQDSLIKAMPQVIAARPDAQLLIVGSGRYESTLRRLATDVSQ 253

Query: 303 VDIFLG--DTIGEMGFYLRMTEIAFIGRSFCASG-----GQNPLEAAMLGCAILSGPNVE 355
              FLG  +    +         A   R+          G   LEA   G  +++     
Sbjct: 254 NVKFLGRLEYQDMINTLAAADIFAMPARTRGGGLDVEGLGIVYLEAQACGVPVIA-GTSG 312

Query: 356 NFRDIYRRMVSSGAVRIVEE--VGTLADMVYSLLSEPTIRYEMINAAINEVKK 406
              +     V+     +VE   V  L++++  LL +P  R  M  A    V+ 
Sbjct: 313 GAPET----VTPATGLVVEGSDVDKLSELLIELLDDPIRRAAMGAAGRAHVEA 361


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target440 3-deoxy-D-manno-octulosonic-acid transferase [Candidatu
2jjm_A394 Glycosyl transferase, group 1 family protein; anthrax, 99.78
3c48_A438 Predicted glycosyltransferases; retaining glycosyltrans 99.73
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); GT4 gl 99.7
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.20A {P 99.68
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; tran 99.66
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mannose, 99.53
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80A {Ha 99.49
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two do 99.45
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentape 99.44
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.41
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allost 99.41
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.27
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.27
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobaci 98.9
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 98.76
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family GT-4, 98.48
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino monom 99.68
3fro_A439 GLGA glycogen synthase; glycosyltransferase family, UDP 99.52
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosyltran 99.03
3iaa_A416 CALG2; glycosyltransferase, calicheamicin, TDP, enediyn 99.57
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic resi 99.43
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediyne, t 99.36
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydrate, g 99.32
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycola 98.66
1rrv_A416 Glycosyltransferase GTFD; GT-B, rossmann fold; HET: DVV 98.59
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; vancomyc 98.56
2p6p_A384 Glycosyl transferase; GT-B family, X-RAY-diffraction,ur 98.43
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen synthase 97.9
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fold, r 99.22
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 5 UD 99.08
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold, ros 99.0
3l7i_A729 Teichoic acid biosynthesis protein F; GT-B fold, monoto 98.5
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases, xan 98.47
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta protein 98.44
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransferase, 98.21
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WINE, ca 98.07
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation 98.05
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransferase, 97.96
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glycosyltr 97.78
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, rossm 97.55
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni 98.2
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural geno 97.81
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1. 97.5
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} Back     alignment and structure
Probab=99.78  E-value=9.7e-17  Score=128.15  Aligned_cols=336  Identities=13%  Similarity=0.042  Sum_probs=199.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEE-EECCCCCCHHHHCCCCCCEEEEE-----------CCCCC--CHHHHHHHHHHCCEEE
Q ss_conf             9999999999999861998999-96277630012101477416885-----------05572--0134455744202035
Q gi|254780402|r   67 GETMALIGLIPAIRSRHVNVLL-TTMTATSAKVARKYLGQYAIHQY-----------APLDI--QPAVSRFLKYWKPDCM  132 (440)
Q Consensus        67 GE~~~a~pli~~l~~~~~~ili-T~~T~tg~~~~~~~~~~~~~~~y-----------~P~D~--~~~~~~fl~~~~P~~~  132 (440)
                      |=-..+..|++.|.+++.+|-+ |...+...+   ... +.+....           .|++.  .....+.+...+|+++
T Consensus        28 G~~~~~~~La~~L~~~Gh~V~vit~~~~~~~~---~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~Dii  103 (394)
T 2jjm_A           28 GSGVVGTELGKQLAERGHEIHFITSGLPFRLN---KVY-PNIYFHEVTVNQYSVFQYPPYDLALASKMAEVAQRENLDIL  103 (394)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEECSSCC-------CCC-TTEEEECCCCC----CCSCCHHHHHHHHHHHHHHHHTCSEE
T ss_pred             CHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC---CCC-CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             59999999999999779989999479986521---137-97069970466665001461369999999999987499689


Q ss_pred             EEECCCCH---HHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHCC--CCEEE
Q ss_conf             64047621---46788874224550586412665421210011112331026442366415778889986088--50587
Q gi|254780402|r  133 ILSESDIW---PLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGA--QKLIV  207 (440)
Q Consensus       133 i~~e~ElW---Pnli~~~~~~~ip~~linarls~~S~~~~~~~~~l~~~~~~~~~~i~~qs~~~~~rl~~lG~--~~i~v  207 (440)
                      ..-.....   ..+.......++|++...-...........++..+.+..++..+.+.+.|+...+.+.+.+.  +++.+
T Consensus       104 ~~~~~~~~~~~~~l~~~~~~~~~~~v~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~i~~  183 (394)
T 2jjm_A          104 HVHYAIPHAICAYLAKQMIGERIKIVTTLHGTDITVLGSDPSLNNLIRFGIEQSDVVTAVSHSLINETHELVKPNKDIQT  183 (394)
T ss_dssp             EECSSTTHHHHHHHHHHHTTTCSEEEEECCHHHHHTTTTCTTTHHHHHHHHHHSSEEEESCHHHHHHHHHHTCCSSCEEE
T ss_pred             EECCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHCCCCCCEEE
T ss_conf             98887707999999998539997299995786411111107799999999974889999248899999996188566899


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEE-CCCCCCCC-CCCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             20431012344221256899998617986175-04655332-10000000000123412488970552114788877653
Q gi|254780402|r  208 SGNLKIDTESLPCDKELLSLYQESIAGRYTWA-AISTFEGE-EDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIERRLIA  285 (440)
Q Consensus       208 ~GnlK~d~~~~~~~~~~~~~~~~~~~~r~v~v-agSth~~E-E~~il~a~~~l~~~~~~~lIIvPRhpeR~~~i~~~l~~  285 (440)
                      ..+.-......+.+............++++++ +|+..+.. -+.+++++..+.+.++..++|+...+++ +++.+.+++
T Consensus       184 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Gr~~~~K~~~~li~a~~~~~~~~~~~~~i~G~g~~~-~~l~~~~~~  262 (394)
T 2jjm_A          184 VYNFIDERVYFKRDMTQLKKEYGISESEKILIHISNFRKVKRVQDVVQAFAKIVTEVDAKLLLVGDGPEF-CTILQLVKN  262 (394)
T ss_dssp             CCCCCCTTTCCCCCCHHHHHHTTCC---CEEEEECCCCGGGTHHHHHHHHHHHHHSSCCEEEEECCCTTH-HHHHHHHHT
T ss_pred             ECCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCC-CCCCCCHHC
T ss_conf             6676663235875678887751888667379987504543004566667765112331157752388511-011110001


Q ss_pred             HCCHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHCCCEEEECCCCCCCCCCHHHHHHHCCCEEECCCCCCHHHHHHHHH
Q ss_conf             00101100134444466416750676520255422082066135544454583768961994999898443799999999
Q gi|254780402|r  286 KGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFRDIYRRMV  365 (440)
Q Consensus       286 ~gl~~~~~S~~~~~~~~~~V~i~Dt~GeL~~lY~~AdiafVGGSl~~~GGhN~lEpaa~G~pVi~GP~~~nf~e~~~~L~  365 (440)
                      .++.....-.+             ..-++..+|..||+ +|-.|..+..|-.++||+++|+|||..+ .....|.+   .
T Consensus       263 ~~~~~~~~~~~-------------~~~~~~~~~~~adi-~v~ps~~e~~~~~~~EAma~G~PvI~s~-~gg~~e~v---~  324 (394)
T 2jjm_A          263 LHIEDRVLFLG-------------KQDNVAELLAMSDL-MLLLSEKESFGLVLLEAMACGVPCIGTR-VGGIPEVI---Q  324 (394)
T ss_dssp             TTCGGGBCCCB-------------SCSCTHHHHHTCSE-EEECCSCCSCCHHHHHHHHTTCCEEEEC-CTTSTTTC---C
T ss_pred             CCCCCCEEECC-------------CHHHCCHHHHHHCC-CCCCCCCCCCCHHHHHHHHCCCCEEEEC-CCCHHHHH---C
T ss_conf             47665301035-------------41210002333202-4676311011147799985598389927-99869985---0


Q ss_pred             HCCCEEEE--CCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             78986995--79899999999995898999999999999997045569999999997523787
Q gi|254780402|r  366 SSGAVRIV--EEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGPLKITLRSLDSYVNPLI  426 (440)
Q Consensus       366 ~~g~~~~v--~d~~eL~~~l~~ll~d~~~~~~~~~~a~~~i~~~~ga~~~~~~~i~~~l~~~~  426 (440)
                      +...+..+  .|.++|++++.++++||+.+++|+++|++.+.++- ..+++.+.+.+.++.++
T Consensus       325 ~~~~G~l~~~~d~~~l~~~i~~ll~~~~~~~~~~~~a~~~~~~~f-s~~~~~~~~~~iy~~ll  386 (394)
T 2jjm_A          325 HGDTGYLCEVGDTTGVADQAIQLLKDEELHRNMGERARESVYEQF-RSEKIVSQYETIYYDVL  386 (394)
T ss_dssp             BTTTEEEECTTCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHS-CHHHHHHHHHHHHHHTC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHH
T ss_conf             797189977999999999999997699999999999999999868-99999999999999998



>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate assisted catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, binary complex; HET: GDP; 2.40A {Mycobacterium smegmatis str} PDB: 2gej_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xmp_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back