254780403

254780403

hypothetical protein CLIBASIA_01440

GeneID in NCBI database:8209388Locus tag:CLIBASIA_01440
Protein GI in NCBI database:254780403Protein Accession:YP_003064816.1
Gene range:-(304618, 304860)Protein Length:80aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:Uncharacterized protein, Bsl7517 homolog
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
ccccccccEEEEEEEcEEEEcccccccccHHHcEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccc
ccccccccEEEEEEEccEEccccccEEccHHHccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
MINGIQEEQVLYLVFGGElenitqkkmrnpddidvVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVdisrfphyelgke
MINGIQEEQVLYLVFGGELENitqkkmrnpddIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
***********YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDIS**********
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
*****QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHY*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE
MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target80 hypothetical protein CLIBASIA_01440 [Candidatus Liberib
31512218582 hypothetical protein CKC_02175 [Candidatus Liberibacter 1 3e-28
24084992781 hypothetical protein Bgr_02800 [Bartonella grahamii as4 1 1e-17
16386755681 hypothetical protein Btr_0293 [Bartonella tribocorum CI 1 4e-16
12160243877 hypothetical protein BARBAKC583_1206 [Bartonella bacill 1 3e-15
4947391481 hypothetical protein BQ02530 [Bartonella quintana str. 1 1e-14
4947507681 hypothetical protein BH02650 [Bartonella henselae str. 1 2e-14
11476970380 hypothetical protein OM2255_09051 [alpha proteobacteriu 1 3e-14
89052892108 hypothetical protein Jann_0401 [Jannaschia sp. CCS1] Le 1 5e-14
25447202580 inositol monophosphatase family protein [Pseudovibrio s 1 6e-14
11470577077 hypothetical protein FP2506_14929 [Fulvimarina pelagi H 1 9e-14
>gi|315122185|ref|YP_004062674.1| hypothetical protein CKC_02175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 82 Back     alignment and organism information
 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          I +EQ LYLVFGGELE IT+KK+RN DDIDVVGIFSSYS+AYD WKEKSQQ VDNALMRY
Sbjct: 7  IDKEQALYLVFGGELEEITKKKIRNLDDIDVVGIFSSYSSAYDAWKEKSQQTVDNALMRY 66

Query: 65 FVVDISRFPHYELGKE 80
          FVVDISRFP+ +L K+
Sbjct: 67 FVVDISRFPYCDLEKK 82


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|240849927|ref|YP_002971316.1| hypothetical protein Bgr_02800 [Bartonella grahamii as4aup] Length = 81 Back     alignment and organism information
>gi|163867556|ref|YP_001608755.1| hypothetical protein Btr_0293 [Bartonella tribocorum CIP 105476] Length = 81 Back     alignment and organism information
>gi|121602438|ref|YP_989459.1| hypothetical protein BARBAKC583_1206 [Bartonella bacilliformis KC583] Length = 77 Back     alignment and organism information
>gi|49473914|ref|YP_031956.1| hypothetical protein BQ02530 [Bartonella quintana str. Toulouse] Length = 81 Back     alignment and organism information
>gi|49475076|ref|YP_033117.1| hypothetical protein BH02650 [Bartonella henselae str. Houston-1] Length = 81 Back     alignment and organism information
>gi|114769703|ref|ZP_01447313.1| hypothetical protein OM2255_09051 [alpha proteobacterium HTCC2255] Length = 80 Back     alignment and organism information
>gi|89052892|ref|YP_508343.1| hypothetical protein Jann_0401 [Jannaschia sp. CCS1] Length = 108 Back     alignment and organism information
>gi|254472025|ref|ZP_05085426.1| inositol monophosphatase family protein [Pseudovibrio sp. JE062] Length = 80 Back     alignment and organism information
>gi|114705770|ref|ZP_01438673.1| hypothetical protein FP2506_14929 [Fulvimarina pelagi HTCC2506] Length = 77 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00