254780410

254780410

hypothetical protein CLIBASIA_01475

GeneID in NCBI database:8209395Locus tag:CLIBASIA_01475
Protein GI in NCBI database:254780410Protein Accession:YP_003064823.1
Gene range:-(311278, 312366)Protein Length:362aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:Uncharacterized conserved protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN
cccHHHHHHHHHHHccccEEHHHHHHHHHHccccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHcccHHHcEEEEEEEccHHHHHHHHHHccccccccEEEccHHHcccccEEEEEEccccccEEEEEEEccccEEEEEEEEcccccEEEEccccccHHHHHcccccccccEEEEcHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHcccccccHHHcccccccccccHHHHHHHHHHcccEEEEEEHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHEEEEcccccccccccc
ccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEcccccccccccccccHcHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccHHHHHHcEEEEEccHHHHHHHHHHccccccccEEHccccccccccEEEEEccHcccccccEEEEEcccEEEEEEEEcccccEEEEEccccccHHHccccccccccEEEccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHccccEcccccHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccc
MENKLIRKIVNLIKKNGQMTVDQYFALCvadpefgyystcnpfgavgdfvtapeISQIFGEMLAIFLICAweqhgfpscvrlvelgpgrgimMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASygdkinwytsladvplgFTFLVANeffdslpikqfvmtEHGIrermididqhdslvfnigdheiksnfltcsdyflgaifenspcrdremQSISDRLACDGGTAIVIDYGylqsrvgdTLQAvkghtyvsplvnpgqadlsshvdfQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKvelmpfvn
MENKLIRKIVNLikkngqmtVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVstsadkksmgeLFKILVvshekvelmpfvn
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN
***KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFS*************SVKRLVSTSADKKSMGELFKILVVSHEKV*LMPFV*
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN
*ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN
MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
315122147368 hypothetical protein CKC_01985 [Candidatus Liberibacter 1 1e-157
222086587365 hypothetical protein Arad_3178 [Agrobacterium radiobact 1 1e-103
218463849366 hypothetical protein RetlK5_32579 [Rhizobium etli Kim 5 1 1e-100
227822833367 putative transcriptional regulator, TetR family [Sinorh 1 1e-100
190892761366 hypothetical protein RHECIAT_CH0003177 [Rhizobium etli 1 1e-100
327188366366 hypothetical protein RHECNPAF_900038 [Rhizobium etli CN 1 1e-100
86358621366 hypothetical protein RHE_CH03019 [Rhizobium etli CFN 42 1 1e-100
209550338366 hypothetical protein Rleg2_2759 [Rhizobium leguminosaru 1 3e-99
241205722366 hypothetical protein Rleg_3022 [Rhizobium leguminosarum 1 6e-99
150397453367 hypothetical protein Smed_2253 [Sinorhizobium medicae W 1 9e-99
>gi|315122147|ref|YP_004062636.1| hypothetical protein CKC_01985 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 368 Back     alignment and organism information
 Score =  557 bits (1435), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 304/362 (83%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           ++  L +KIV+LIK+NGQ+T+DQYF+LC++D EFGYY TCNPFG  GDFVTAPEISQIFG
Sbjct: 3   VKTGLYQKIVDLIKRNGQITIDQYFSLCLSDSEFGYYKTCNPFGVDGDFVTAPEISQIFG 62

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EMLAIFLI AWEQHGFP CVRL+E+GPGRG MMLD+LR ICKL+PDFF++LSIYM+E SE
Sbjct: 63  EMLAIFLIFAWEQHGFPRCVRLIEMGPGRGTMMLDVLRTICKLRPDFFAILSIYMIENSE 122

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  IQKK L+ YGDKINW   ++DVP GFTFL+ANEFFDSLPIKQFV+T  G+RERMID
Sbjct: 123 RLVSIQKKNLSFYGDKINWCVGISDVPPGFTFLMANEFFDSLPIKQFVITNDGMRERMID 182

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           ID H+ LVF IG + I S     +DYF G I E SPCRD  +QSI+DRL C+GGTAIVID
Sbjct: 183 IDHHELLVFGIGKNAITSPVSPFNDYFPGMILETSPCRDSAIQSIADRLVCEGGTAIVID 242

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+LQS +GDTLQAVKGH Y  PL++PGQADLSSHVDFQRLSSI+IL KLYING   QGK
Sbjct: 243 YGHLQSGMGDTLQAVKGHKYDPPLMHPGQADLSSHVDFQRLSSISILRKLYINGCVKQGK 302

Query: 301 FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           FLE LGIWQR FSLMK T R DILLDSV+RLV   +D KSMGELFK+LVVSH KV+L+PF
Sbjct: 303 FLECLGIWQRVFSLMKNTDRADILLDSVRRLVGMPSDDKSMGELFKVLVVSHRKVDLVPF 362

Query: 361 VN 362
           VN
Sbjct: 363 VN 364


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086587|ref|YP_002545121.1| hypothetical protein Arad_3178 [Agrobacterium radiobacter K84] Length = 365 Back     alignment and organism information
>gi|218463849|ref|ZP_03503940.1| hypothetical protein RetlK5_32579 [Rhizobium etli Kim 5] Length = 366 Back     alignment and organism information
>gi|227822833|ref|YP_002826805.1| putative transcriptional regulator, TetR family [Sinorhizobium fredii NGR234] Length = 367 Back     alignment and organism information
>gi|190892761|ref|YP_001979303.1| hypothetical protein RHECIAT_CH0003177 [Rhizobium etli CIAT 652] Length = 366 Back     alignment and organism information
>gi|327188366|gb|EGE55583.1| hypothetical protein RHECNPAF_900038 [Rhizobium etli CNPAF512] Length = 366 Back     alignment and organism information
>gi|86358621|ref|YP_470513.1| hypothetical protein RHE_CH03019 [Rhizobium etli CFN 42] Length = 366 Back     alignment and organism information
>gi|209550338|ref|YP_002282255.1| hypothetical protein Rleg2_2759 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 366 Back     alignment and organism information
>gi|241205722|ref|YP_002976818.1| hypothetical protein Rleg_3022 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 366 Back     alignment and organism information
>gi|150397453|ref|YP_001327920.1| hypothetical protein Smed_2253 [Sinorhizobium medicae WSM419] Length = 367 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
KOG2901415 KOG2901, KOG2901, KOG2901, Uncharacterized conserved pr 5e-68
COG1565370 COG1565, COG1565, Uncharacterized conserved protein [Fu 1e-83
pfam02636240 pfam02636, DUF185, Uncharacterized ACR, COG1565 1e-55
>gnl|CDD|38112 KOG2901, KOG2901, KOG2901, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|31753 COG1565, COG1565, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|145672 pfam02636, DUF185, Uncharacterized ACR, COG1565 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
COG1565370 Uncharacterized conserved protein [Function unknown] 100.0
KOG2901415 consensus 100.0
pfam02636240 DUF185 Uncharacterized ACR, COG1565. This family contai 100.0
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 94.95
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 97.25
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 97.12
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 96.99
PTZ00338296 dimethyladenosine transferase; Provisional 96.95
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 96.66
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 96.48
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 96.39
PRK08317241 hypothetical protein; Provisional 96.36
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 96.36
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 96.29
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 96.19
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 96.12
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 96.05
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 95.71
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 95.7
PRK11036256 putative metallothionein SmtA; Provisional 95.68
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 95.58
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 95.41
KOG0822649 consensus 95.17
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 94.76
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 94.64
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 93.98
PRK10258251 biotin biosynthesis protein BioC; Provisional 93.96
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 93.96
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 93.8
KOG2904328 consensus 93.66
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 93.63
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 93.52
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 91.6
TIGR02987 603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 90.92
PRK06202233 hypothetical protein; Provisional 96.86
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 95.76
pfam05175170 MTS Methyltransferase small domain. This domain is foun 95.57
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 95.09
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.71
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 96.32
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 95.56
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 95.36
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 94.87
KOG0820315 consensus 94.85
PRK07402196 precorrin-6B methylase; Provisional 94.15
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 93.95
TIGR03438301 probable methyltransferase. This model represents a dis 93.63
pfam05206256 TRM13 Methyltransferase TRM13. This is a family of euka 93.27
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 93.16
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 92.94
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 92.46
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 92.3
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 92.19
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 91.87
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 90.89
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 95.61
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 93.97
PHA02056279 putative methyltransferase 95.39
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 95.21
COG4123248 Predicted O-methyltransferase [General function predict 94.55
KOG2361264 consensus 93.22
pfam05219265 DREV DREV methyltransferase. This family contains DREV 91.93
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2901 consensus Back     alignment and domain information
>pfam02636 DUF185 Uncharacterized ACR, COG1565 Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0822 consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>pfam05206 TRM13 Methyltransferase TRM13 Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
1zkd_A387 X-Ray Structure Of The Putative Protein Q6n1p6 From 4e-76
>gi|67464609|pdb|1ZKD|A Chain A, X-Ray Structure Of The Putative Protein Q6n1p6 From Rhodopseudomonas Palustris At The Resolution 2.1 A , Northeast Structural Genomics Consortium Target Rpr58 Length = 387 Back     alignment and structure
 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 139/360 (38%), Positives = 195/360 (54%), Gaps = 12/360 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L  +I  LIK  G   V +Y  LC+  PE GYY T +P G  GDF T+PEISQ FGE+
Sbjct: 5   TALATEIKRLIKAAGPXPVWRYXELCLGHPEHGYYVTRDPLGREGDFTTSPEISQXFGEL 64

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++    W+    P  +RL+E+GPGRG    D LR +  L P  +  LS+++VE +  L
Sbjct: 65  LGLWSASVWKAADEPQTLRLIEIGPGRGTXXADALRALRVL-PILYQSLSVHLVEINPVL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q+  LA   + I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I 
Sbjct: 124 RQKQQTLLAGIRN-IHWHDSFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEIG 182

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDY----FLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
               LVF +    I                GA+FE  P  +  +  I+ R+   GG A++
Sbjct: 183 ASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTE--ILKIASRVRDQGGAALI 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  TQ
Sbjct: 241 IDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQ 300

Query: 299 GKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL+ LGI  RA SL  +   +  + +  +++RL          G  FK++ VS  K+E
Sbjct: 301 GAFLKRLGIETRALSLXAKATPQVSEDIAGALQRLTGEGRGAX--GSXFKVIGVSDPKIE 358


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
1zkd_A387 DUF185; X-RAY, NESG, RPR58, structural genomics, PSI, p 1e-65
>1zkd_A DUF185; X-RAY, NESG, RPR58, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; 2.10A {Rhodopseudomonas palustris CGA009} SCOP: c.66.1.52 Length = 387 Back     alignment and structure
 Score =  245 bits (626), Expect = 1e-65
 Identities = 138/362 (38%), Positives = 198/362 (54%), Gaps = 8/362 (2%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L  +I  LIK  G M V +Y  LC+  PE GYY T +P G  GDF T+PEISQ+FGE
Sbjct: 4   QTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+    P  +RL+E+GPGRG MM        ++ P  +  LS+++VE +  
Sbjct: 64  LLGLWSASVWKAADEPQTLRLIEIGPGRGTMM-ADALRALRVLPILYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA     I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I
Sbjct: 123 LRQKQQTLLAGI-RNIHWHDSFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFLGAI--FENSPCRDREMQSISDRLACDGGTAIVI 239
                LVF +    I             +          D E+  I+ R+   GG A++I
Sbjct: 182 GASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTEILKIASRVRDQGGAALII 241

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  TQG
Sbjct: 242 DYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQG 301

Query: 300 KFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
            FL+ LGI  RA SLM +      + +  +++RL  T   + +MG +FK++ VS  K+E 
Sbjct: 302 AFLKRLGIETRALSLMAKATPQVSEDIAGALQRL--TGEGRGAMGSMFKVIGVSDPKIET 359

Query: 358 MP 359
           + 
Sbjct: 360 LV 361


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target362 hypothetical protein CLIBASIA_01475 [Candidatus Liberib
1zkd_A387 DUF185; X-RAY, NESG, RPR58, structural genomics, PSI, p 100.0
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 97.52
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 97.06
2aot_A292 HMT, histamine N-methyltransferase; classic methyltrans 97.06
3gru_A295 Dimethyladenosine transferase; rossman fold, ribosomal 97.05
1zq9_A285 Probable dimethyladenosine transferase; SGC, structural 96.97
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 96.85
1wzn_A252 SAM-dependent methyltransferase; structural genomics, r 96.83
1i4w_A353 Mitochondrial replication protein MTF1; mitochondrial t 96.75
1qyr_A252 KSGA, high level kasugamycin resistance protein, S-; ad 96.74
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 96.59
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, structur 96.55
1ve3_A227 Hypothetical protein PH0226; dimer, riken structural ge 96.53
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 96.49
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoaspartyl 96.37
1xxl_A239 YCGJ protein; structural genomics, protein structure in 96.36
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent meth 96.35
3g5t_A299 Trans-aconitate 3-methyltransferase; structural genomic 96.24
2b3t_A276 Protein methyltransferase HEMK; translation termination 96.21
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 96.16
1vl5_A260 Unknown conserved protein BH2331; 10174951, hypothetica 96.12
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 95.8
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 95.79
2b25_A336 Hypothetical protein; structural genomics, methyl trans 95.78
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethionine-d 95.63
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- methy 95.61
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 95.57
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 95.56
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; struc 95.45
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena vari 95.43
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 94.99
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 94.96
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 specif 94.94
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 94.84
1xva_A292 Glycine N-methyltransferase; HET: SAM; 2.20A {Escherich 94.8
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 94.78
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 94.78
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 94.78
3ege_A261 Putative methyltransferase from antibiotic biosynthesis 94.61
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messenger 94.51
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta- aspart 94.44
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, structura 94.37
3lcc_A235 Putative methyl chloride transferase; halide methyltran 94.32
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 94.3
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 94.02
2okc_A445 Type I restriction enzyme stysji M protein; NP_813429.1 93.91
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossman-typ 93.79
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 93.76
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 93.65
3c3p_A210 Methyltransferase; NP_951602.1, structural genomics, jo 93.54
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, 93.28
3duw_A223 OMT, O-methyltransferase, putative; alternating of alph 93.04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 92.78
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 92.73
2gpy_A233 O-methyltransferase; structural genomics, PSI, protein 92.68
3hvi_A221 Catechol O-methyltransferase; neurotransmitter degradat 92.52
1nw3_A416 Histone methyltransferase DOT1L; HDOT1, histone lysine 92.34
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-adenosy 92.29
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeMet, b 91.76
3khk_A544 Type I restriction-modification system methylation subu 91.57
3fut_A271 Dimethyladenosine transferase; methyltransferase, dimet 97.33
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NMR {St 96.86
2h1r_A299 Dimethyladenosine transferase, putative; SGC toronto di 96.8
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like fold 96.66
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-adenosyl 95.64
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent methylt 94.92
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O- methyltransferas 94.52
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modified ro 90.01
3dtn_A234 Putative methyltransferase MM_2633; structural genomics 96.84
3gu3_A284 Methyltransferase; alpha-beta protein, structural genom 96.63
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha/beta 96.55
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransferase, S 96.36
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 96.34
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; NP_34 95.98
3f4k_A257 Putative methyltransferase; structural genomics, PSI-2, 95.77
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, SAH, S 95.52
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 94.49
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 94.46
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 94.26
3b3f_A341 Histone-arginine methyltransferase CARM1; protein argin 94.2
3lpm_A259 Putative methyltransferase; structural genomics, protei 94.12
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, structu 93.84
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; antibiot 93.39
1or8_A340 Protein arginine N-methyltransferase 1; protein arginin 92.84
2fyt_A340 Protein arginine N-methyltransferase 3; structural geno 92.75
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 91.8
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding domain, 91.31
3b3j_A480 Histone-arginine methyltransferase CARM1; protein argin 90.43
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, protein 96.72
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; HET: S 96.7
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 96.59
2o57_A297 Putative sarcosine dimethylglycine methyltransferase; s 96.35
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 95.36
3ndi_A416 Methyltransferase; S-adenosylmethionine, kijanose, tetr 94.74
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fold; HE 93.63
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, meth 93.25
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipid syn 92.53
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 92.27
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 96.46
3ou2_A218 SAM-dependent methyltransferase; O-methyltransferase, S 96.37
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 96.28
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 96.16
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 96.04
3cc8_A230 Putative methyltransferase; NP_977653.1, structural gen 95.95
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 95.9
2i6g_A199 Putative methyltransferase; 16420133, structural genomi 95.82
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 95.72
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 95.58
3g5l_A253 Putative S-adenosylmethionine dependent methyltransfera 95.57
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltransfer 95.31
2p7i_A250 Hypothetical protein; putative methyltransferase, struc 95.25
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 95.05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 95.0
3gjy_A317 Spermidine synthase; APC62791, structural genomics, PSI 94.86
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 94.83
3e8s_A227 Putative SAM dependent methyltransferase; NP_744700.1, 94.83
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, methyltra 94.72
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 94.7
3i9f_A170 Putative type 11 methyltransferase; structural genomics 94.58
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 94.41
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protein, st 94.35
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 93.2
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxylating); 93.14
2r3s_A335 Uncharacterized protein; methyltransferase domain, stru 93.07
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 92.11
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 92.0
1vlm_A219 SAM-dependent methyltransferase; possible histamine N-m 91.47
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, structura 91.18
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adeno 90.48
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 90.22
3ocj_A305 Putative exported protein; structural genomics, PSI-2, 90.1
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleotidyltr 96.23
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; protei 92.53
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 95.83
2ip2_A334 Probable phenazine-specific methyltransferase; pyocyani 92.62
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracycline 92.38
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 90.1
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 95.78
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal RNA pr 94.93
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D 94.59
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransferase 91.73
1x19_A359 CRTF-related protein; methyltransferase, bacteriochlloc 91.38
>1zkd_A DUF185; X-RAY, NESG, RPR58, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; 2.10A {Rhodopseudomonas palustris CGA009} SCOP: c.66.1.52 Back     alignment and structure
Probab=100.00  E-value=0  Score=723.98  Aligned_cols=352  Identities=41%  Similarity=0.668  Sum_probs=316.2

Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             84899999999981898049999998710898786468988888888645767117999999999999999838887621
Q gi|254780410|r    2 ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVR   81 (362)
Q Consensus         2 ~~~L~~~i~~~I~~~G~i~f~~fM~~aLy~p~~GYY~~~~~~G~~GDF~Tsp~is~~Fg~~ia~~~~~~~~~~~~p~~~~   81 (362)
                      .++|.++|+++|+++|||||++||++|||||++|||+++++||++||||||||+||+||++||+|+.++|+.++.|++++
T Consensus         4 ~t~L~~~i~~~I~~~GpIsf~~fM~~aLy~p~~GYY~~~~~iG~~GDF~TSpeis~~FG~~ia~~~~~~~~~~~~p~~~~   83 (387)
T 1zkd_A            4 QTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQTLR   83 (387)
T ss_dssp             SSHHHHHHHHHHHHHCSEEHHHHHHHHHHCTTTCTTTCC--------CCSHHHHCHHHHHHHHHHHHHHHHHTTCCSSEE
T ss_pred             CCHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             41799999999995699579999999718998634478998889987468740579999999999999999759997716


Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCHHHHHCCCEEEEECCHHHHHHHHHHHHHCCCCHHCCCCHHHCCCCCEEEEEECCCCC
Q ss_conf             41007864689888799997418564301210236369789999986411102310110434444569569998122887
Q gi|254780410|r   82 LVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDS  161 (362)
Q Consensus        82 ivE~GaG~G~La~diL~~l~~~~p~~~~~l~~~ivE~s~~l~~~Q~~~l~~~~~~v~w~~~l~~~~~~~~iiiaNE~lDA  161 (362)
                      |||+|||+|+||+||++.++ ..|.++..++|++||+|+.|++.|+++|+.. .++.|+++++++|..++||+|||||||
T Consensus        84 ivE~GaG~G~L~~DIl~~~~-~~p~~~~~~~~~~vE~s~~Lr~~Q~~~L~~~-~~i~~~~~l~~~~~~~giiiANE~fDA  161 (387)
T 1zkd_A           84 LIEIGPGRGTMMADALRALR-VLPILYQSLSVHLVEINPVLRQKQQTLLAGI-RNIHWHDSFEDVPEGPAVILANEYFDV  161 (387)
T ss_dssp             EEEECCTTSHHHHHHHHHHT-TSHHHHTTEEEEEECCCHHHHHHHHHHSTTC-SSEEEESSGGGSCCSSEEEEEESSGGG
T ss_pred             EEEECCCCCHHHHHHHHHHH-HCHHHHHCCEEEEEECCHHHHHHHHHHHCCC-CCEEEECCHHHCCCCCCEEEECCCCCC
T ss_conf             99967982078998999986-4815441345899936878889999872477-740474142117788814761223566


Q ss_pred             CCEEEEEEECCCCEEEEEEEEECCCEEECCCCCCCCCCCC---C-CCCCCCCCEECCCHHHHHHHHHHHHHHHHCCEEEE
Q ss_conf             5235899915664689989960795352257643432234---6-33165684112793478999999997620570599
Q gi|254780410|r  162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFL---T-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI  237 (362)
Q Consensus       162 lPv~~~~~~~~~w~E~~V~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~~g~~~E~~~~~~~~~~~i~~~l~~~~G~~L  237 (362)
                      ||||||++++++|+|++|++++++++.|...+.+.+....   . ....++|++.|+++....|.......+  ++|++|
T Consensus       162 lPv~~f~~~~~~w~E~~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~e~~~~~~~~~~~~~~~~--~~G~~L  239 (387)
T 1zkd_A          162 LPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTEILKIASRVRD--QGGAAL  239 (387)
T ss_dssp             SCCEEEEEETTEEEEEEEEECTTSCEEEEECSSCCTTCGGGSCGGGGGCCTTCEEEECCSHHHHHHHHHHHH--HCEEEE
T ss_pred             CCCEEEEECCCCEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHH--CCCCEE
T ss_conf             650479984883378753216521045402568645578763244014888847860658999998899986--488678


Q ss_pred             EECCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEECCEEHHHHHHHCCHHHHHHHHHHC
Q ss_conf             96243368588880776405767670001000345312688999999996898363323389999978979999998708
Q gi|254780410|r  238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ  317 (362)
Q Consensus       238 ~iDYGy~~~r~~gTLr~y~~H~~~dpl~~pG~~DITahVnFs~L~~~a~~~g~~~~g~~sQ~~FL~~~GI~~r~~~l~~~  317 (362)
                      +|||||...+.++|+|+|++|+++|||.+||+|||||||||++|+++++++|+++.|++||++||+++||.+|++.+.++
T Consensus       240 ~IDYG~~~~~~g~~l~~~~~h~~~d~l~~pG~~DITahVdFs~L~~~~~~~g~~~~g~~tQ~~FL~~~GI~er~~~l~~~  319 (387)
T 1zkd_A          240 IIDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQGAFLKRLGIETRALSLMAK  319 (387)
T ss_dssp             EEEEEESSCCBCCCCEEECSSSEECTTSSTTSSEEECCEEHHHHHHHHHHTTCEEEEEEEHHHHHHHTTHHHHHHHHHHT
T ss_pred             EECCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEECCCCHHHHHHHCCHHHHHHHHHCC
T ss_conf             60332246765672556642545666468995626677498999999997799870645799999978999999999756


Q ss_pred             CCCHH--HHHHHHHHHHHCCCCHH--HCCCEEEEEEEECCCCC-CCCCC
Q ss_conf             46279--99999999861468822--31632699998078888-99888
Q gi|254780410|r  318 TARKD--ILLDSVKRLVSTSADKK--SMGELFKILVVSHEKVE-LMPFV  361 (362)
Q Consensus       318 ~~~~~--~~~~~~~rli~~l~~p~--~MGe~FKVl~~sk~~~~-~~~f~  361 (362)
                      .+...  .+..+++||+    +|+  +|||+||||++|+++.+ +++|-
T Consensus       320 ~~~~~~~~l~~~~krLi----~p~~~~MGe~FKVL~is~~~~~~~~~~~  364 (387)
T 1zkd_A          320 ATPQVSEDIAGALQRLT----GEGRGAMGSMFKVIGVSDPKIETLVALS  364 (387)
T ss_dssp             SCHHHHHHHHHHHHHHH----CEETTEETTTEEEEEEECTTCCCCTTTT
T ss_pred             CCHHHHHHHHHHHHHCC----CCCCCHHHHHEEEEEECCCCCCCCCCCC
T ss_conf             99899999999998625----9882101154789998279998777889



>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assembly S-adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.66.1.43 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1im8_A YECO; methyltransferase, adenosylhomocysteine, structural genomics, hypothetical protein, structure 2 function project, S2F; HET: SAI; 2.20A {Haemophilus influenzae rd KW20} SCOP: c.66.1.14 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; NP_988299.1, structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold; HET: SAM; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly, inter-subunit disulfide bridge; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomics, JCSG, PSI, protein structure initiative; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.50A {Clostridium acetobutylicum atcc 824} SCOP: c.66.1.43 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics, protein structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1xva_A Glycine N-methyltransferase; HET: SAM; 2.20A {Escherichia coli} SCOP: c.66.1.5 PDB: 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, PSI, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosynthesis pathway; YP_324569.1, structural genomics; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta- aspartate methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, structural genomics; 2.00A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 1pry_A Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; HET: MSE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>3hvi_A Catechol O-methyltransferase; neurotransmitter degradation, alternative initiation, catecholamine metabolism, cell membrane, cytoplasm; HET: 619; 1.20A {Rattus norvegicus} PDB: 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 2zlb_A 2zth_A* 2zvj_A* 3a7d_A* 3bwm_A* 3bwy_A* 3a7e_A* Back     alignment and structure
>1nw3_A Histone methyltransferase DOT1L; HDOT1, histone lysine methyltransferase,; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.31 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, coiled coil, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.66.1.3 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus HB8} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, antibiotic resistance, methyltransferase; 1.44A {Aquifex aeolicus VF5} PDB: 3ftc_A 3fte_A 3ftf_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1, methyltransferase domain, structural genomics; HET: MSE; 1.60A {Mesorhizobium loti MAFF303099} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O- methyltransferase; isomerization, protein repair, S- adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.30A {Bacillus cereus atcc 14579} PDB: 2gh1_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, protein structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus HB8} PDB: 2yr0_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3b3f_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, catalytic domain, alternative splicing, chromatin regulator; HET: SAH; 2.20A {Rattus norvegicus} PDB: 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1or8_A Protein arginine N-methyltransferase 1; protein arginine methylation, adoMet-dependent methylation, transferase; HET: SAH; 2.35A {Rattus norvegicus} SCOP: c.66.1.6 PDB: 1orh_A* 1ori_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 1f3l_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, alternative splicing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative, SAM-dependent methyltransferase; HET: SAI; 1.94A {Leishmania major strain friedlin} SCOP: c.66.1.42 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ndi_A Methyltransferase; S-adenosylmethionine, kijanose, tetronitrose, tetradeoxysuga micromonospora chalcea, TCAB9, SUGA methylation; HET: SAM TMP; 1.50A {Micromonospora chalcea} PDB: 3ndj_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in europe; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase- like protein, methyltransferase domain; 1.85A {Lactobacillus casei atcc 334} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cc8_A Putative methyltransferase; NP_977653.1, structural genomics, joint center for structural genomics, JCSG; 1.64A {Bacillus cereus atcc 10987} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2i6g_A Putative methyltransferase; 16420133, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MLY; 1.90A {Salmonella typhimurium LT2} SCOP: c.66.1.44 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA; HET: SAH; 2.60A {Thermus thermophilus HB8} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima MSB8} SCOP: c.66.1.41 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genomics, JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.15A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S- adenosylmethionine-dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine N-methyltransferase, structural genomics, JCSG, protein structure initiative, PSI; 2.20A {Thermotoga maritima MSB8} SCOP: c.66.1.41 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural genomics, joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA processing, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} PDB: 1kpi_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure