254780411

254780411

prolipoprotein diacylglyceryl transferase

GeneID in NCBI database:8209396Locus tag:CLIBASIA_01480
Protein GI in NCBI database:254780411Protein Accession:YP_003064824.1
Gene range:-(312356, 313222)Protein Length:288aa
Gene description:prolipoprotein diacylglyceryl transferase
COG prediction:[M] Prolipoprotein diacylglyceryltransferase
KEGG prediction:prolipoprotein diacylglyceryl transferase; K13292 phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC:2.-.-.-]
SEED prediction:Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Lipoprotein Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED8 TM-Helix
HMMTOP7 TM-Helix
MEMSAT7 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKSGSSFGK
ccccHHHHHHHccccccHHHHEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccHHcccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHccHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEEccEEcccccccccHccccccccccHccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHccccccccc
MEREYMLWSIltypnlnpvalslgpIAIRWYGLAYLVGMLFGIWYIQYLlgkpalwtekqnnenlvykegdcqesCFFWLAISVIVGGRIMYVLFYNwqvfwnsplhifflweggmsfhggLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINgelwgrvswvpwamvfpdggslprhpsqLYEAITEGLMIFLIMQLMVYrgsfkspgltagAFAICYSVVRFFMEffrepdyqlgyLLGGWMTMGMILSILPFLVGVGMVFQsmnsksgssfgk
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSmnsksgssfgk
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKSGSSFGK
**REYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQ************
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMN*********
*EREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSK*******
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxhhhhhhhhhhhhhhhhhhhhxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKSGSSFGK
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKSGSSFGK
MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKSGSSFGK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target288 prolipoprotein diacylglyceryl transferase [Candidatus L
315122146281 prolipoprotein diacylglyceryl transferase [Candidatus L 1 1e-120
298292439280 prolipoprotein diacylglyceryl transferase [Starkeya nov 1 1e-69
154252709276 prolipoprotein diacylglyceryl transferase [Parvibaculum 1 2e-65
114707031297 prolipoprotein diacylglyceryl transferase protein [Fulv 1 4e-65
150397452280 prolipoprotein diacylglyceryl transferase [Sinorhizobiu 1 4e-65
325293571280 prolipoprotein diacylglyceryl transferase [Agrobacteriu 1 5e-65
154246489272 prolipoprotein diacylglyceryl transferase [Xanthobacter 1 8e-65
75676688291 prolipoprotein diacylglyceryl transferase [Nitrobacter 1 1e-64
158425606271 prolipoprotein diacylglyceryl transferase [Azorhizobium 1 2e-64
239832409281 prolipoprotein diacylglyceryl transferase [Ochrobactrum 1 3e-64
>gi|315122146|ref|YP_004062635.1| prolipoprotein diacylglyceryl transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 281 Back     alignment and organism information
 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/277 (74%), Positives = 245/277 (88%)

Query: 6   MLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWYIQYLLGKPALWTEKQNNENL 65
           ML S+L YPN++P+A+SLGP+AIRWYGL+YLVG+ FGIWY++YLL KP LWTE+QN++NL
Sbjct: 1   MLLSVLMYPNIDPIAISLGPLAIRWYGLSYLVGIFFGIWYMRYLLDKPLLWTEEQNHKNL 60

Query: 66  VYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNSPLHIFFLWEGGMSFHGGLIGA 125
           VYK  DCQE   FW+ +S+IVGGRI YVLFYNW++FW  PLHIFFLWEGGMSFHGGLIGA
Sbjct: 61  VYKTDDCQEKFSFWVVVSMIVGGRIAYVLFYNWKIFWEFPLHIFFLWEGGMSFHGGLIGA 120

Query: 126 FVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANFINGELWGRVSWVPWAMVFPDGG 185
           F+SLF+LSRI+ FSF +FLDL+AAS PVGIFLGRIANFINGELWG+VSWVPWAMVFP+GG
Sbjct: 121 FLSLFVLSRIFKFSFWVFLDLIAASAPVGIFLGRIANFINGELWGKVSWVPWAMVFPNGG 180

Query: 186 SLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRFFMEFFREPD 245
            LPRHPSQLYEA +EGL+IFLIMQ MVY G+ K PGLTAG F+ICY++ R  MEFFREPD
Sbjct: 181 DLPRHPSQLYEAFSEGLVIFLIMQWMVYHGALKKPGLTAGVFSICYAIARIGMEFFREPD 240

Query: 246 YQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSKS 282
           YQLGYLL GW+TMGM+LSIL  ++G+ +VFQ++ +KS
Sbjct: 241 YQLGYLLDGWVTMGMVLSILTLIIGIWIVFQAVRTKS 277


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|298292439|ref|YP_003694378.1| prolipoprotein diacylglyceryl transferase [Starkeya novella DSM 506] Length = 280 Back     alignment and organism information
>gi|154252709|ref|YP_001413533.1| prolipoprotein diacylglyceryl transferase [Parvibaculum lavamentivorans DS-1] Length = 276 Back     alignment and organism information
>gi|114707031|ref|ZP_01439930.1| prolipoprotein diacylglyceryl transferase protein [Fulvimarina pelagi HTCC2506] Length = 297 Back     alignment and organism information
>gi|150397452|ref|YP_001327919.1| prolipoprotein diacylglyceryl transferase [Sinorhizobium medicae WSM419] Length = 280 Back     alignment and organism information
>gi|325293571|ref|YP_004279435.1| prolipoprotein diacylglyceryl transferase [Agrobacterium sp. H13-3] Length = 280 Back     alignment and organism information
>gi|154246489|ref|YP_001417447.1| prolipoprotein diacylglyceryl transferase [Xanthobacter autotrophicus Py2] Length = 272 Back     alignment and organism information
>gi|75676688|ref|YP_319109.1| prolipoprotein diacylglyceryl transferase [Nitrobacter winogradskyi Nb-255] Length = 291 Back     alignment and organism information
>gi|158425606|ref|YP_001526898.1| prolipoprotein diacylglyceryl transferase [Azorhizobium caulinodans ORS 571] Length = 271 Back     alignment and organism information
>gi|239832409|ref|ZP_04680738.1| prolipoprotein diacylglyceryl transferase [Ochrobactrum intermedium LMG 3301] Length = 281 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target288 prolipoprotein diacylglyceryl transferase [Candidatus L
PRK00052269 PRK00052, PRK00052, prolipoprotein diacylglyceryl trans 2e-73
COG0682287 COG0682, Lgt, Prolipoprotein diacylglyceryltransferase 2e-54
TIGR00544278 TIGR00544, lgt, prolipoprotein diacylglyceryl transfera 3e-49
PRK12437269 PRK12437, PRK12437, prolipoprotein diacylglyceryl trans 1e-47
pfam01790257 pfam01790, LGT, Prolipoprotein diacylglyceryl transfera 2e-63
PRK13108 460 PRK13108, PRK13108, prolipoprotein diacylglyceryl trans 5e-13
>gnl|CDD|178826 PRK00052, PRK00052, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|31026 COG0682, Lgt, Prolipoprotein diacylglyceryltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|161919 TIGR00544, lgt, prolipoprotein diacylglyceryl transferase Back     alignment and domain information
>gnl|CDD|183527 PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|110765 pfam01790, LGT, Prolipoprotein diacylglyceryl transferase Back     alignment and domain information
>gnl|CDD|171865 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 288 prolipoprotein diacylglyceryl transferase [Candidatus L
PRK12437269 prolipoprotein diacylglyceryl transferase; Reviewed 100.0
pfam01790257 LGT Prolipoprotein diacylglyceryl transferase. 100.0
PRK00052253 prolipoprotein diacylglyceryl transferase; Reviewed 100.0
COG0682287 Lgt Prolipoprotein diacylglyceryltransferase [Cell enve 100.0
PRK13108 460 prolipoprotein diacylglyceryl transferase; Reviewed 100.0
TIGR00544358 lgt prolipoprotein diacylglyceryl transferase; InterPro 100.0
>PRK12437 prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>pfam01790 LGT Prolipoprotein diacylglyceryl transferase Back     alignment and domain information
>PRK00052 prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>COG0682 Lgt Prolipoprotein diacylglyceryltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13108 prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>TIGR00544 lgt prolipoprotein diacylglyceryl transferase; InterPro: IPR001640 Prolipoprotein diacylglyceryl transferase is the bacterial enzyme that catalyzes the first step in lipoprotein biogenesis, it transfers the n-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00