254780412

254780412

hypothetical protein CLIBASIA_01485

GeneID in NCBI database:8209397Locus tag:CLIBASIA_01485
Protein GI in NCBI database:254780412Protein Accession:YP_003064825.1
Gene range:+(313384, 313668)Protein Length:94aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKiqrtlnsmgvvraeeienvkrttshlREEITAIGKRLEKIEQQLADLELFINQKEKE
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE
*****NQ**QQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKI*****************
**********QASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE
*****NQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKE**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRxxxxxxxxxxxxxxxxxxxxx
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE
MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target94 hypothetical protein CLIBASIA_01485 [Candidatus Liberib
31512214594 hypothetical protein CKC_01975 [Candidatus Liberibacter 1 1e-25
163761590109 hypothetical protein HPDFL43_13792 [Hoeflea phototrophi 1 5e-05
20988630484 hypothetical protein OCAR_7192 [Oligotropha carboxidovo 1 7e-04
319781895100 hypothetical protein Mesci_2169 [Mesorhizobium ciceri b 1 0.001
15918544087 hypothetical protein Atu8173 [Agrobacterium tumefaciens 1 0.002
1596609595 hypothetical protein SMc03744 [Sinorhizobium meliloti 1 1 0.003
13472393100 hypothetical protein mll2675 [Mesorhizobium loti MAFF30 1 0.003
85716020106 hypothetical protein NB311A_14425 [Nitrobacter sp. Nb-3 2 5e-18
15039745196 hypothetical protein Smed_2251 [Sinorhizobium medicae W 2 3e-17
14634282696 hypothetical protein BRADO6005 [Bradyrhizobium sp. ORS2 2 4e-17
>gi|315122145|ref|YP_004062634.1| hypothetical protein CKC_01975 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 94 Back     alignment and organism information
 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 77/94 (81%)

Query: 1  MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTT 60
          MSF+ +Q F QASRLA CAS AF++ISKEAESFAQ+K+Q+TLNSMGVVR+E++E +K   
Sbjct: 1  MSFKPDQIFNQASRLADCASSAFQNISKEAESFAQVKLQKTLNSMGVVRSEDVEAIKSMI 60

Query: 61 SHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94
          S++RE +T++ +RLE IE+QLAD +    +KEKE
Sbjct: 61 SNIRENLTSVCERLETIEKQLADFKSPAKKKEKE 94


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163761590|ref|ZP_02168661.1| hypothetical protein HPDFL43_13792 [Hoeflea phototrophica DFL-43] Length = 109 Back     alignment and organism information
>gi|209886304|ref|YP_002290161.1| hypothetical protein OCAR_7192 [Oligotropha carboxidovorans OM5] Length = 84 Back     alignment and organism information
>gi|319781895|ref|YP_004141371.1| hypothetical protein Mesci_2169 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 100 Back     alignment and organism information
>gi|159185440|ref|NP_355169.2| hypothetical protein Atu8173 [Agrobacterium tumefaciens str. C58] Length = 87 Back     alignment and organism information
>gi|15966095|ref|NP_386448.1| hypothetical protein SMc03744 [Sinorhizobium meliloti 1021] Length = 95 Back     alignment and organism information
>gi|13472393|ref|NP_103960.1| hypothetical protein mll2675 [Mesorhizobium loti MAFF303099] Length = 100 Back     alignment and organism information
>gi|85716020|ref|ZP_01046997.1| hypothetical protein NB311A_14425 [Nitrobacter sp. Nb-311A] Length = 106 Back     alignment and organism information
>gi|150397451|ref|YP_001327918.1| hypothetical protein Smed_2251 [Sinorhizobium medicae WSM419] Length = 96 Back     alignment and organism information
>gi|146342826|ref|YP_001207874.1| hypothetical protein BRADO6005 [Bradyrhizobium sp. ORS278] Length = 96 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target94 hypothetical protein CLIBASIA_01485 [Candidatus Liberib
COG2960103 COG2960, COG2960, Uncharacterized protein conserved in 0.004
>gnl|CDD|32780 COG2960, COG2960, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 94 hypothetical protein CLIBASIA_01485 [Candidatus Liberib
COG2960103 Uncharacterized protein conserved in bacteria [Function 99.82
pfam0438070 DUF526 Protein of unknown function (DUF526). 99.8
pfam05597132 Phasin Poly(hydroxyalcanoate) granule associated protei 96.97
COG3937108 Uncharacterized conserved protein [Function unknown] 96.85
TIGR01837121 PHA_granule_1 poly(hydroxyalkanoate) granule-associated 96.19
TIGR01834332 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, 93.32
pfam09712293 PHA_synth_III_E Poly(R)-hydroxyalkanoic acid synthase s 92.84
pfam12126 284 DUF3583 Protein of unknown function (DUF3583). This dom 90.93
>COG2960 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04380 DUF526 Protein of unknown function (DUF526) Back     alignment and domain information
>pfam05597 Phasin Poly(hydroxyalcanoate) granule associated protein (phasin) Back     alignment and domain information
>COG3937 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01837 PHA_granule_1 poly(hydroxyalkanoate) granule-associated protein; InterPro: IPR008769 Polyhydroxyalkanoates (PHAs) are storage polyesters synthesised by various bacteria as intracellular carbon and energy reserve material Back     alignment and domain information
>TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit; InterPro: IPR010123 This entry represents the PhaE subunit of the heterodimeric class (class III) of polymerase for poly(R)-hydroxyalkanoic acids (PHAs), carbon and energy storage polymers of many bacteria Back     alignment and domain information
>pfam09712 PHA_synth_III_E Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E) Back     alignment and domain information
>pfam12126 DUF3583 Protein of unknown function (DUF3583) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target94 hypothetical protein CLIBASIA_01485 [Candidatus Liberib
2pnv_A43 Small conductance calcium-activated potassium channel p 91.86
>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
Probab=91.86  E-value=0.33  Score=27.34  Aligned_cols=35  Identities=26%  Similarity=0.232  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999650
Q gi|254780412|r   55 NVKRTTSHLREEITAIGKRLEKIEQQLADLELFIN   89 (94)
Q Consensus        55 v~~~~l~k~R~~~e~Le~rl~~LE~kl~~le~~~~   89 (94)
                      +.-+++.-..++.+.||+||..||.||..+-+.+.
T Consensus         6 vMYdlvSeL~~rsEdlEkri~~LEtkLd~l~~slq   40 (43)
T 2pnv_A            6 IMYDMISDLNERSEDFEKRIVTLETKLETLIGSIH   40 (43)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998768999999999989999998874




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target94 hypothetical protein CLIBASIA_01485 [Candidatus Liberib
2pnv_A_43 Small conductance calcium-activated potassium chan 91.71
>2pnv_A (A:) Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
Probab=91.71  E-value=0.5  Score=27.17  Aligned_cols=36  Identities=25%  Similarity=0.234  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999650
Q gi|254780412|r   54 ENVKRTTSHLREEITAIGKRLEKIEQQLADLELFIN   89 (94)
Q Consensus        54 dv~~~~l~k~R~~~e~Le~rl~~LE~kl~~le~~~~   89 (94)
                      .+.-++..-..++.+.||+||..||.||..+-+-+.
T Consensus         5 nvMYdlvSeL~~rsEdlEkri~~LE~kle~L~aslq   40 (43)
T 2pnv_A            5 NIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIH   40 (43)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             799999999998758999999999999999988874