254780420

254780420

carbamoyl phosphate synthase small subunit

GeneID in NCBI database:8209406Locus tag:CLIBASIA_01525
Protein GI in NCBI database:254780420Protein Accession:YP_003064833.1
Gene range:-(325252, 326442)Protein Length:396aa
Gene description:carbamoyl phosphate synthase small subunit
COG prediction:[E] [F] Carbamoylphosphate synthase small subunit
KEGG prediction:carA; carbamoyl phosphate synthase small subunit (EC:6.3.5.5); K01956 carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
SEED prediction:Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC
cccccccccccccEEEEEccccEEEEEEEccccEEEEEEEEEcccccccEEcccccccccEEEEccccccccccccccccccccccccEEEEEEEcccccccccHHHHccHHHHHHHcccEEEccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEccccccHHHHcccHHHHHHHHHHccccEEEEcHHHHHHHHHcccEEEEccccccccEEEEEEcccccEEEEEEEEEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHccc
ccccccccccccEEEEEEccccEEEEEEccEcEEEEEEEEEEcccccHHHHHccHHHEcEEEEEcccEcccccEccccccccccccccEEEEEEEcccccccccccccccHHHHHHHcccEEEEcccHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccccHHEEEccccccEEcccccEccccccccccccccEEEEEEEccccHHHHHHHHHccEEEEEEEccccHHHHHcccccEEEEcccccccccccHHHHHHHHHHHcccccEEEEcHHHHHHHHcccccEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccEEEEEEEcccccEEEEEEccccEEEEccccccccccHHHccHHHHHHHHHHHHHccc
mtvtlpwtikkptAVLVLAdgsviegmgcgatgsiQAEICFntsltgyqeiltdpsylgqivnftfphignvgvnsedfesisrknFKGAVGLVIKAEitepsnyranmhFDAWLKSCGIiglsgidtRALTVWIRDygvsnsviahhpdgqfdlEDLKERAKNwsglkgaeLAKHVTVSQRRDWSEKIWKWGEetsflkssdakyHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKdimslqpdgvllsngpgdpavtsvysspiicklvdsgmpmfgiCLGHQLLGLALGAQTVkmyqghhgvnhpvknisnGTVEIVSMnhgfaidasslpagleethislfdssncgfrlidqpvfsvqyhpesspgpqdsyyLFSTFIDFMHKRKTMC
mtvtlpwtikkptaVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWsglkgaelakhvtvsqrrdwsekIWKWGeetsflkssdakYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPEsspgpqdsyyLFSTFIDFMHKRKTMC
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGIClghqllglalgaqTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC
***********PTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEET****SSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRK***
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKH********WSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQ********PQDSYYLFSTFIDFMHKRKTMC
*******TIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC
MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target396 carbamoyl phosphate synthase small subunit [Candidatus
254780414 520 GMP synthase [Candidatus Liberibacter asiaticus st 1e-06
>gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 520 Back     alignment
 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 208 VVCIDYGIRSNLL--RVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVY 265
           V+ ID+G +   L  R +        ++  + +        P  ++LS   G PA +   
Sbjct: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILS---GSPASSLDI 66

Query: 266 SSPIICK-LVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVN--HPVKNIS------ 316
            SP I K +++S +P+ GIC G Q++  +LG +T        G       KN S      
Sbjct: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126

Query: 317 -NGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQ--PVFSVQYHPE 370
             G+ + V M+HG  ++   +P G E   I+  DS+   F + D+    ++VQ+HPE
Sbjct: 127 EKGSKQQVWMSHGDQVE--HIPEGFEV--IASSDSTPFAF-IADEKRKYYAVQFHPE 178

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target396 carbamoyl phosphate synthase small subunit [Candidatus
315122136402 carbamoyl phosphate synthase small subunit [Candidatus 1 0.0
325293531401 carbamoyl-phosphate synthase small chain [Agrobacterium 1 1e-156
222149287406 carbamoyl phosphate synthase small subunit [Agrobacteri 1 1e-155
15966073401 carbamoyl phosphate synthase small subunit [Sinorhizobi 1 1e-154
159185084401 carbamoyl phosphate synthase small subunit [Agrobacteri 1 1e-154
307317631401 carbamoyl-phosphate synthase, small subunit [Sinorhizob 1 1e-154
190892708401 carbamoyl-phosphate synthase (glutamine-hydrolyzing) pr 1 1e-154
115257801417 putative carbamoyl-phosphate synthase small chain [Rhiz 1 1e-154
222086548402 carbamoyl-phosphate synthase small chain (glutamine-hyd 1 1e-154
241205667403 carbamoyl phosphate synthase small subunit [Rhizobium l 1 1e-154
>gi|315122136|ref|YP_004062625.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 402 Back     alignment and organism information
 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/393 (80%), Positives = 362/393 (92%)

Query: 1   MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQ 60
           M V LPWTIKK TAVLVL DGSVIEGMGCGATG +QAE+CFNTSLTGYQEILTDPSYLGQ
Sbjct: 1   MIVNLPWTIKKHTAVLVLTDGSVIEGMGCGATGFVQAEVCFNTSLTGYQEILTDPSYLGQ 60

Query: 61  IVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGI 120
           IVNFTFPHIGNVGVN+EDFES+S KNF+GA GLVIKA+IT+ SNYRAN H D WLKSCGI
Sbjct: 61  IVNFTFPHIGNVGVNNEDFESLSTKNFQGAAGLVIKADITDSSNYRANTHLDVWLKSCGI 120

Query: 121 IGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVS 180
           IGLSG+DTRALT+WIR++G +N+VIAHHP+GQFDL+DLKERA+NW+GLKGAELAK  TV 
Sbjct: 121 IGLSGVDTRALTIWIREHGATNAVIAHHPEGQFDLDDLKERARNWTGLKGAELAKRATVF 180

Query: 181 QRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYK 240
           Q+RDW EK WKWGE  SFL  +DA YHVVCIDYG++SN+L++L++LGC+ TI+ A+TSY+
Sbjct: 181 QKRDWLEKSWKWGEVPSFLNPNDAHYHVVCIDYGVKSNILKILANLGCKTTIMSADTSYE 240

Query: 241 DIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVK 300
           DI+SL PDGVLLSNGPGDPA T++Y+SP+ICKLVDSG+P+FGICLGHQLLGLALGA+T+K
Sbjct: 241 DILSLHPDGVLLSNGPGDPAATAMYTSPVICKLVDSGIPIFGICLGHQLLGLALGAKTIK 300

Query: 301 MYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQ 360
           MYQGHHG NHPVKN+SNG VEIVSMNHGFAID ++LPAGLEETHISLFD+SNCG RL+D+
Sbjct: 301 MYQGHHGANHPVKNLSNGRVEIVSMNHGFAIDTNTLPAGLEETHISLFDNSNCGLRLVDR 360

Query: 361 PVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRK 393
           PVFSVQYHPESSPGPQDSYYLFSTF+DFM +RK
Sbjct: 361 PVFSVQYHPESSPGPQDSYYLFSTFVDFMRQRK 393


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293531|ref|YP_004279395.1| carbamoyl-phosphate synthase small chain [Agrobacterium sp. H13-3] Length = 401 Back     alignment and organism information
>gi|222149287|ref|YP_002550244.1| carbamoyl phosphate synthase small subunit [Agrobacterium vitis S4] Length = 406 Back     alignment and organism information
>gi|15966073|ref|NP_386426.1| carbamoyl phosphate synthase small subunit [Sinorhizobium meliloti 1021] Length = 401 Back     alignment and organism information
>gi|159185084|ref|NP_355130.2| carbamoyl phosphate synthase small subunit [Agrobacterium tumefaciens str. C58] Length = 401 Back     alignment and organism information
>gi|307317631|ref|ZP_07597070.1| carbamoyl-phosphate synthase, small subunit [Sinorhizobium meliloti AK83] Length = 401 Back     alignment and organism information
>gi|190892708|ref|YP_001979250.1| carbamoyl-phosphate synthase (glutamine-hydrolyzing) protein, small chain [Rhizobium etli CIAT 652] Length = 401 Back     alignment and organism information
>gi|115257801|emb|CAK08899.1| putative carbamoyl-phosphate synthase small chain [Rhizobium leguminosarum bv. viciae 3841] Length = 417 Back     alignment and organism information
>gi|222086548|ref|YP_002545082.1| carbamoyl-phosphate synthase small chain (glutamine-hydrolysing) protein [Agrobacterium radiobacter K84] Length = 402 Back     alignment and organism information
>gi|241205667|ref|YP_002976763.1| carbamoyl phosphate synthase small subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 carbamoyl phosphate synthase small subunit [Candidatus
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase small 1e-158
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, 1e-122
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase small 1e-103
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase arginine-s 1e-91
PLN02771415 PLN02771, PLN02771, carbamoyl-phosphate synthase (gluta 4e-83
KOG0370 1435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 7e-83
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small subuni 1e-136
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutamine-d 6e-73
pfam00117187 pfam00117, GATase, Glutamine amidotransferase class-I 5e-46
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamin 4e-22
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate synthase 2e-19
PRK05670189 PRK05670, PRK05670, anthranilate synthase component II; 7e-16
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotransfe 9e-14
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotransferas 2e-13
PRK06774191 PRK06774, PRK06774, para-aminobenzoate synthase compone 2e-13
TIGR00566188 TIGR00566, trpG_papA, glutamine amidotransferase of ant 5e-13
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotr 1e-12
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyz 2e-12
cd01741188 cd01741, GATase1_1, Subgroup of proteins having the Typ 1e-11
PRK08857193 PRK08857, PRK08857, para-aminobenzoate synthase compone 1e-11
PRK08007187 PRK08007, PRK08007, para-aminobenzoate synthase compone 6e-11
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 5e-10
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 2e-09
KOG0026223 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta 3e-09
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilate syn 4e-09
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alpha pr 5e-09
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Validated 7e-09
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 2e-08
PLN02335222 PLN02335, PLN02335, anthranilate synthase 2e-08
KOG1224 767 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) sy 4e-08
TIGR01823 742 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, 5e-08
PLN02347 536 PLN02347, PLN02347, GMP synthetase 3e-07
KOG1622 552 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide tra 7e-07
cd01745189 cd01745, GATase1_2, Subgroup of proteins having the Typ 1e-06
PRK05637208 PRK05637, PRK05637, anthranilate synthase component II; 2e-05
PRK09522 531 PRK09522, PRK09522, bifunctional glutamine amidotransfe 4e-05
cd01747273 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine a 0.003
pfam00988131 pfam00988, CPSase_sm_chain, Carbamoyl-phosphate synthas 2e-53
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase compone 2e-12
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisional 2e-09
COG2071243 COG2071, COG2071, Predicted glutamine amidotransferases 1e-06
PLN02889 918 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthas 3e-05
PRK07053234 PRK07053, PRK07053, glutamine amidotransferase; Provisi 9e-04
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferase (GA 3e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATa 3e-08
PRK09065237 PRK09065, PRK09065, glutamine amidotransferase; Provisi 7e-07
cd01748198 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotr 2e-05
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synthase s 4e-05
PRK13143200 PRK13143, hisH, imidazole glycerol phosphate synthase s 2e-04
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino acid t 0.003
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase comp 4e-06
>gnl|CDD|183597 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162320 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180190 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|184763 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|161933 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|178842 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|116336 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|35249 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|164502 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information
>gnl|CDD|36438 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|162548 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>gnl|CDD|177981 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|180178 PRK05637, PRK05637, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>gnl|CDD|144543 pfam00988, CPSase_sm_chain, Carbamoyl-phosphate synthase small chain, CPSase domain Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|184147 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178477 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>gnl|CDD|180812 PRK07053, PRK07053, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>gnl|CDD|183868 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|183869 PRK13143, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|168720 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 396 carbamoyl phosphate synthase small subunit [Candidatus
TIGR01368383 CPSaseIIsmall carbamoyl-phosphate synthase, small subun 100.0
CHL00197383 carA carbamoyl-phosphate synthase arginine-specific sma 100.0
PRK12564355 carbamoyl phosphate synthase small subunit; Reviewed 100.0
COG0505368 CarA Carbamoylphosphate synthase small subunit [Amino a 100.0
PRK12838356 carbamoyl phosphate synthase small subunit; Reviewed 100.0
KOG0370 1435 consensus 100.0
pfam00988131 CPSase_sm_chain Carbamoyl-phosphate synthase small chai 100.0
cd01744178 GATase1_CPSase Small chain of the glutamine-dependent f 100.0
PRK05670192 anthranilate synthase component II; Provisional 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 100.0
pfam00117187 GATase Glutamine amidotransferase class-I. 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisional 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransferase 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisional 100.0
PRK08857192 para-aminobenzoate synthase component II; Provisional 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine amidotra 100.0
PRK13566724 anthranilate synthase; Provisional 100.0
TIGR00888195 guaA_Nterm GMP synthase, N-terminal domain; InterPro: I 100.0
PRK07765221 para-aminobenzoate synthase component II; Provisional 100.0
PRK06895191 para-aminobenzoate synthase component II; Provisional 100.0
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 100.0
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
PRK00074 513 guaA GMP synthase; Reviewed 100.0
TIGR00566212 trpG_papA glutamine amidotransferase of anthranilate sy 99.97
KOG0026223 consensus 99.94
TIGR01823 851 PabB-fungal para-aminobenzoate synthase; InterPro: IPR0 99.93
COG0518198 GuaA GMP synthase - Glutamine amidotransferase domain [ 99.91
PRK13143201 hisH imidazole glycerol phosphate synthase subunit HisH 99.9
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 glutam 99.88
KOG1622 552 consensus 99.88
KOG1224 767 consensus 99.87
PRK13141204 hisH imidazole glycerol phosphate synthase subunit HisH 99.87
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Prov 99.86
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransferase 99.86
PRK13175206 consensus 99.86
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 glutam 99.86
pfam07722219 Peptidase_C26 Peptidase C26. These peptidases have gamm 99.85
PRK13181199 hisH imidazole glycerol phosphate synthase subunit HisH 99.84
COG2071243 Predicted glutamine amidotransferases [General function 99.79
PRK09065238 glutamine amidotransferase; Provisional 99.77
PRK13180209 consensus 99.75
PRK13144190 consensus 99.75
PRK13152201 hisH imidazole glycerol phosphate synthase subunit HisH 99.74
PRK07053235 glutamine amidotransferase; Provisional 99.74
PRK13177207 consensus 99.74
PRK06490243 glutamine amidotransferase; Provisional 99.73
PRK13146208 hisH imidazole glycerol phosphate synthase subunit HisH 99.73
PRK13153203 consensus 99.72
PRK13170196 hisH imidazole glycerol phosphate synthase subunit HisH 99.72
PRK08250235 glutamine amidotransferase; Provisional 99.71
PRK13172213 consensus 99.71
PRK13176216 consensus 99.71
PRK13171200 consensus 99.71
PRK13178213 consensus 99.7
PRK13174212 consensus 99.69
CHL00188210 hisH imidazole glycerol phosphate synthase subunit hisH 99.68
PRK13525191 glutamine amidotransferase subunit PdxT; Provisional 99.67
PRK13179207 consensus 99.67
PRK13173211 consensus 99.67
PRK13148225 consensus 99.66
PRK13151195 consensus 99.66
COG0118204 HisH Glutamine amidotransferase [Amino acid transport a 99.66
TIGR01855211 IMP_synth_hisH imidazole glycerol phosphate synthase, g 99.65
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransf 99.63
PRK13147211 consensus 99.62
PRK13142192 hisH imidazole glycerol phosphate synthase subunit HisH 99.54
pfam01174188 SNO SNO glutamine amidotransferase family. This family 99.54
PRK13527196 glutamine amidotransferase subunit PdxT; Provisional 99.52
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) involv 99.47
TIGR00337571 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is 99.44
KOG3179245 consensus 99.23
KOG1559340 consensus 98.77
KOG0623 541 consensus 98.59
TIGR01737264 FGAM_synth_I phosphoribosylformylglycinamidine synthase 98.43
PRK01175255 phosphoribosylformylglycinamidine synthase subunit I; P 98.4
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 98.36
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATa 98.22
PRK13526179 glutamine amidotransferase subunit PdxT; Provisional 98.04
COG0311194 PDX2 Predicted glutamine amidotransferase involved in p 97.09
TIGR018571279 FGAM-synthase phosphoribosylformylglycinamidine synthas 93.8
COG3442250 Predicted glutamine amidotransferase [General function 93.71
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 99.98
PRK05380534 pyrG CTP synthetase; Validated 99.7
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide trans 99.65
PRK05665240 amidotransferase; Provisional 99.72
PRK07567242 glutamine amidotransferase; Provisional 99.7
PRK06186229 hypothetical protein; Validated 99.55
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransferase 99.55
KOG2387585 consensus 98.8
PRK03619223 phosphoribosylformylglycinamidine synthase subunit I; P 98.3
PRK05368302 homoserine O-succinyltransferase; Provisional 97.43
pfam04204298 HTS Homoserine O-succinyltransferase. 97.32
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 97.94
TIGR01382189 PfpI intracellular protease, PfpI family; InterPro: IPR 97.93
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1 97.91
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1)-lik 97.45
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like 96.86
KOG3210226 consensus 95.58
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GATase1 95.37
PRK052971294 phosphoribosylformylglycinamidine synthase; Provisional 91.06
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 97.06
pfam07685158 GATase_3 CobB/CobQ-like glutamine amidotransferase doma 97.05
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATas 96.72
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1 96.01
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATas 95.81
pfam01965141 DJ-1_PfpI DJ-1/PfpI family. The family includes the pro 95.35
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransferase ( 94.33
PRK11574196 hypothetical protein; Provisional 94.12
KOG2764247 consensus 92.73
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GATase1) 92.55
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 92.24
COG0693188 ThiJ Putative intracellular protease/amidase [General f 91.83
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransferase (G 90.66
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase (GAT 90.07
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 96.3
PRK00784492 cobyric acid synthase; Provisional 95.98
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 94.84
PRK06278 482 cobyrinic acid a,c-diamide synthase; Validated 94.1
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.6
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>pfam00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>pfam00117 GATase Glutamine amidotransferase class-I Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase, N-terminal domain; InterPro: IPR004739 The N-terminal region of GMP synthase 6 Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221 This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase Back     alignment and domain information
>KOG0026 consensus Back     alignment and domain information
>TIGR01823 PabB-fungal para-aminobenzoate synthase; InterPro: IPR010117 This entry represents the fungal clade of para-aminobenzoate synthase, which acts on chorismate to form para-aminobenzoic acid (PABA), a precursor of folate Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>KOG1224 consensus Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13175 consensus Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>pfam07722 Peptidase_C26 Peptidase C26 Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13180 consensus Back     alignment and domain information
>PRK13144 consensus Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13177 consensus Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13153 consensus Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13172 consensus Back     alignment and domain information
>PRK13176 consensus Back     alignment and domain information
>PRK13171 consensus Back     alignment and domain information
>PRK13178 consensus Back     alignment and domain information
>PRK13174 consensus Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13179 consensus Back     alignment and domain information
>PRK13173 consensus Back     alignment and domain information
>PRK13148 consensus Back     alignment and domain information
>PRK13151 consensus Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139 Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK13147 consensus Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>pfam01174 SNO SNO glutamine amidotransferase family Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism Back     alignment and domain information
>KOG3179 consensus Back     alignment and domain information
>KOG1559 consensus Back     alignment and domain information
>KOG0623 consensus Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I; InterPro: IPR010075 In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>KOG2387 consensus Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>pfam04204 HTS Homoserine O-succinyltransferase Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family; InterPro: IPR006286 Peptidases are grouped into clans and families Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG3210 consensus Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>pfam07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>pfam01965 DJ-1_PfpI DJ-1/PfpI family Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11574 hypothetical protein; Provisional Back     alignment and domain information
>KOG2764 consensus Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target396 carbamoyl phosphate synthase small subunit [Candidatus
1jdb_C382 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-117
1t36_B382 Crystal Structure Of E. Coli Carbamoyl Phosphate Sy 1e-117
1c30_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 1e-117
1cs0_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 1e-116
1m6v_B382 Crystal Structure Of The G359f (Small Subunit) Poin 1e-116
1a9x_B379 Carbamoyl Phosphate Synthetase: Caught In The Act O 1e-115
1qdl_B195 The Crystal Structure Of Anthranilate Synthase From 1e-16
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 4e-11
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 6e-11
2a9v_A212 Crystal Structure Of A Putative Gmp Synthase Subuni 3e-10
2ywb_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 3e-10
2ywc_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 7e-09
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 2e-08
2vpi_A218 Human Gmp Synthetase - Glutaminase Domain Length = 2e-08
1gpm_A 525 Escherichia Coli Gmp Synthetase Complexed With Amp 3e-08
1i1q_B192 Structure Of The Cooperative Allosteric Anthranilat 2e-07
1i7q_B193 Anthranilate Synthase From S. Marcescens Length = 1 2e-07
>gi|3318818|pdb|1JDB|C Chain C, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 382 Back     alignment and structure
 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 178/385 (46%), Positives = 236/385 (61%), Gaps = 8/385 (2%)

Query: 12  PTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGN 71
            +A+LVL DG+   G   GATGS   E+ FNTS+TGYQEILTDPSY  QIV  T+PHIGN
Sbjct: 3   KSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGN 62

Query: 72  VGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRAL 131
           VG N  D ES    +   A GLVI+      SN+R      ++LK   I+ ++ IDTR L
Sbjct: 63  VGTNDADEES----SQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKL 118

Query: 132 TVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWK 191
           T  +R+ G  N  I    +   D     E+A+ + GL G +LAK VT ++   W++  W 
Sbjct: 119 TRLLREKGAQNGCIIAGDNP--DAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWT 176

Query: 192 WGEETSFLKSSDA-KYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGV 250
                   K  D   +HVV  D+G + N+LR+L   GCR+TIV A+TS +D++ + PDG+
Sbjct: 177 LTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGI 236

Query: 251 LLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNH 310
            LSNGPGDPA    Y+   I K +++ +P+FGICLGHQLL LA GA+TVKM  GHHG NH
Sbjct: 237 FLSNGPGDPAPC-DYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNH 295

Query: 311 PVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPE 370
           PVK++    V I + NHGFA+D ++LPA L  TH SLFD +  G    D+P FS Q HPE
Sbjct: 296 PVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPE 355

Query: 371 SSPGPQDSYYLFSTFIDFMHKRKTM 395
           +SPGP D+  LF  FI+ + + +  
Sbjct: 356 ASPGPHDAAPLFDHFIELIEQYRKT 380


>gi|55669822|pdb|1T36|B Chain B, Crystal Structure Of E. Coli Carbamoyl Phosphate Synthetase Small Subunit Mutant C248d Complexed With Uridine 5'- Monophosphate Length = 382 Back     alignment and structure
>gi|6730117|pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small Subunit Mutation C269s Length = 382 Back     alignment and structure
>gi|6730188|pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase Complexed At Cys269 In The Small Subunit With The Tetrahedral Mimic L-Glutamate Gamma-Semialdehyde Length = 382 Back     alignment and structure
>gi|22219402|pdb|1M6V|B Chain B, Crystal Structure Of The G359f (Small Subunit) Point Mutant Of Carbamoyl Phosphate Synthetase Length = 382 Back     alignment and structure
>gi|3891748|pdb|1A9X|B Chain B, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 379 Back     alignment and structure
>gi|5822247|pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195 Back     alignment and structure
>gi|75765330|pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure
>gi|119389149|pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure
>gi|73536186|pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45 A Resolution Length = 212 Back     alignment and structure
gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>gi|159795613|pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>gi|196049679|pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>gi|169791766|pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 Back     alignment and structure
gi|1310841|pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>gi|14278479|pdb|1I1Q|B Chain B, Structure Of The Cooperative Allosteric Anthranilate Synthase From Salmonella Typhimurium Length = 192 Back     alignment and structure
>gi|14277773|pdb|1I7Q|B Chain B, Anthranilate Synthase From S. Marcescens Length = 193 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 carbamoyl phosphate synthase small subunit [Candidatus
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amidotran 1e-105
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptop 2e-28
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine amidotra 3e-26
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 5e-26
1i1q_B192 Anthranilate synthase component II; tryptophan biosynth 7e-25
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 5e-22
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c. 3e-18
1o1y_A239 Conserved hypothetical protein TM1158; structural genom 1e-16
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; transfe 5e-16
3m3p_A250 Glutamine amido transferase; structural genomics, nysgr 3e-15
3l83_A250 Glutamine amido transferase; structural genomics, nysgr 5e-15
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, nysgr 9e-15
2a9v_A212 GMP synthase; NP_394403.1, , structural genomics, joint 6e-14
2vpi_A218 GMP synthase; guanine monophosphate synthetase, phospho 1e-13
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharacterize 5e-09
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis protein 3e-08
1q7r_A219 Predicted amidotransferase; structural genomics, YAAE, 5e-07
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex (lyas 4e-05
1ka9_H200 Imidazole glycerol phosphtate synthase; riken structura 8e-05
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B6, ma 2e-04
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46) 5e-04
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alpha)8- 8e-04
2vdj_A301 Homoserine O-succinyltransferase; methionine biosynthes 0.001
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxine bio 0.004
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Length = 379 Back     alignment and structure
 Score =  376 bits (966), Expect = e-105
 Identities = 177/382 (46%), Positives = 236/382 (61%), Gaps = 8/382 (2%)

Query: 13  TAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNV 72
           +A+LVL DG+   G   GATGS   E+ FNTS+TGYQEILTDPSY  QIV  T+PHIGNV
Sbjct: 3   SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 62

Query: 73  GVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALT 132
           G N  D ES    +   A GLVI+      SN+R      ++LK   I+ ++ IDTR LT
Sbjct: 63  GTNDADEES----SQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLT 118

Query: 133 VWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWK- 191
             +R+ G  N  I        D     E+A+ + GL G +LAK VT ++   W++  W  
Sbjct: 119 RLLREKGAQNGCIIAGD--NPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTL 176

Query: 192 WGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVL 251
            G      K  +  +HVV  D+G + N+LR+L   GCR+TIV A+TS +D++ + PDG+ 
Sbjct: 177 TGGLPQAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIF 236

Query: 252 LSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHP 311
           LSNGPGDPA    Y+   I K +++ +P+FGICLGHQLL LA GA+TVKM  GHHG NHP
Sbjct: 237 LSNGPGDPAPCD-YAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHP 295

Query: 312 VKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPES 371
           VK++    V I + NHGFA+D ++LPA L  TH SLFD +  G    D+P FS Q +PE+
Sbjct: 296 VKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGNPEA 355

Query: 372 SPGPQDSYYLFSTFIDFMHKRK 393
           SPGP D+  LF  FI+ + + +
Sbjct: 356 SPGPHDAAPLFDHFIELIEQYR 377


>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure