254780421

254780421

hypothetical protein CLIBASIA_01530

GeneID in NCBI database:8209407Locus tag:CLIBASIA_01530
Protein GI in NCBI database:254780421Protein Accession:YP_003064834.1
Gene range:+(326801, 327457)Protein Length:218aa
Gene description:hypothetical protein
COG prediction:[R] FOG: TPR repeat
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHcc
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccc
mesnndansykgkckmgkccykwIAPLLILMILSLAIWFYLfdgshekkkniVGENFAQALELFNSNKLDDARSSFEKILSQdnklynplsNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQklsepsnpmhQFANEILGISALKFGKVQKAKTIFEELakdnnspfgistRSQMILANIIasdqrnkk
mesnndansykgkckmGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEelakdnnspfgistrsQMILAniiasdqrnkk
MESNNDANSykgkckmgkccykWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHE***********Q***************SFEKILSQDNKLYNPLSNMYIASILVA*GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL*************SQMILA***********
***********GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII********
********SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS******
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target218 hypothetical protein CLIBASIA_01530 [Candidatus Liberib
315122135220 hypothetical protein CKC_01925 [Candidatus Liberibacter 1 4e-73
16264870222 hypothetical protein SM_b20996 [Sinorhizobium meliloti 1 2e-22
307307990222 Protein of unknown function DUF2133 [Sinorhizobium meli 1 2e-22
227822914222 putative transmembrane protein [Sinorhizobium fredii NG 1 4e-22
307319942222 Protein of unknown function DUF2133 [Sinorhizobium meli 1 4e-22
150376650222 hypothetical protein Smed_4513 [Sinorhizobium medicae W 1 4e-22
116253296227 transmembrane protein [Rhizobium leguminosarum bv. vici 1 6e-22
86358710227 hypothetical protein RHE_CH03109 [Rhizobium etli CFN 42 1 1e-21
241205815227 hypothetical protein Rleg_3116 [Rhizobium leguminosarum 1 2e-21
218516155227 hypothetical protein Retl8_22038 [Rhizobium etli 8C-3] 1 1e-20
>gi|315122135|ref|YP_004062624.1| hypothetical protein CKC_01925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 220 Back     alignment and organism information
 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 143/218 (65%), Positives = 173/218 (79%), Gaps = 1/218 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+SN D +S K  CK+ K  YK I PLLIL++LSLA W YL  GS+ K KN  GE+F+QA
Sbjct: 1   MKSNKDTSSCKEGCKIKKYGYKLIVPLLILIVLSLASWLYLH-GSYNKPKNPAGEDFSQA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L N+NKLDDAR +FEKILS DN+ Y+ ++NMYIASILV KGD K+A+E FLKV NDDL
Sbjct: 60  ISLLNNNKLDDARIAFEKILSYDNRSYDSIANMYIASILVTKGDVKSASEKFLKVGNDDL 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   VRY A L AA ILVDT SY++ISKILQKL +PSNPMH  ANEILGISA+K GK++K
Sbjct: 120 ALPVVRYTAILHAAWILVDTVSYDDISKILQKLIDPSNPMHPAANEILGISAMKCGKIEK 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A++IFEE+ KD NSP GISTRSQ++LANIIAS++  KK
Sbjct: 180 ARSIFEEIVKDPNSPPGISTRSQIMLANIIASNKETKK 217


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|16264870|ref|NP_437662.1| hypothetical protein SM_b20996 [Sinorhizobium meliloti 1021] Length = 222 Back     alignment and organism information
>gi|307307990|ref|ZP_07587708.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C] Length = 222 Back     alignment and organism information
>gi|227822914|ref|YP_002826886.1| putative transmembrane protein [Sinorhizobium fredii NGR234] Length = 222 Back     alignment and organism information
>gi|307319942|ref|ZP_07599365.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83] Length = 222 Back     alignment and organism information
>gi|150376650|ref|YP_001313246.1| hypothetical protein Smed_4513 [Sinorhizobium medicae WSM419] Length = 222 Back     alignment and organism information
>gi|116253296|ref|YP_769134.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 227 Back     alignment and organism information
>gi|86358710|ref|YP_470602.1| hypothetical protein RHE_CH03109 [Rhizobium etli CFN 42] Length = 227 Back     alignment and organism information
>gi|241205815|ref|YP_002976911.1| hypothetical protein Rleg_3116 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 227 Back     alignment and organism information
>gi|218516155|ref|ZP_03512995.1| hypothetical protein Retl8_22038 [Rhizobium etli 8C-3] Length = 227 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target218 hypothetical protein CLIBASIA_01530 [Candidatus Liberib
COG1729262 COG1729, COG1729, Uncharacterized protein conserved in 5e-04
COG4649221 COG4649, COG4649, Uncharacterized protein conserved in 1e-28
>gnl|CDD|31915 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|34268 COG4649, COG4649, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 218 hypothetical protein CLIBASIA_01530 [Candidatus Liberib
COG4649221 Uncharacterized protein conserved in bacteria [Function 100.0
COG2976207 Uncharacterized protein conserved in bacteria [Function 99.96
pfam10858220 DUF2659 Protein of unknown function (DUF2659). This bac 99.68
PRK11788 389 hypothetical protein; Provisional 99.28
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 99.09
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.02
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 99.0
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 98.43
COG2976207 Uncharacterized protein conserved in bacteria [Function 98.38
TIGR00990 649 3a0801s09 mitochondrial precursor proteins import recep 95.8
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 99.08
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.07
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 98.9
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 98.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 98.74
PRK10747 398 putative protoheme IX biogenesis protein; Provisional 98.73
PRK11788 389 hypothetical protein; Provisional 98.67
COG4105254 ComL DNA uptake lipoprotein [General function predictio 98.57
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 98.37
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.37
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.27
KOG4626 966 consensus 98.25
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 98.18
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.17
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 98.15
KOG2376 652 consensus 98.12
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 98.05
KOG0624 504 consensus 98.0
KOG1126638 consensus 97.94
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 97.91
KOG3060289 consensus 97.85
KOG4626 966 consensus 97.83
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 97.8
KOG2002 1018 consensus 97.67
KOG2076 895 consensus 97.57
KOG0547606 consensus 97.57
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 97.53
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 97.53
KOG0624 504 consensus 97.36
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 97.17
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 97.13
KOG0550 486 consensus 97.08
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 97.0
KOG1840508 consensus 97.0
pfam10300446 IML2 Putative mitochondrial outer membrane protein. Thi 96.96
KOG4340 459 consensus 96.95
KOG3060289 consensus 96.84
KOG1173611 consensus 96.63
COG3898 531 Uncharacterized membrane-bound protein [Function unknow 96.48
KOG1125579 consensus 96.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 96.24
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 95.87
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 95.75
COG4105254 ComL DNA uptake lipoprotein [General function predictio 95.45
COG4700251 Uncharacterized protein conserved in bacteria containin 93.98
KOG1156 700 consensus 91.76
PRK10803262 hypothetical protein; Provisional 98.87
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.49
COG1729262 Uncharacterized protein conserved in bacteria [Function 98.43
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 98.25
KOG0553304 consensus 97.81
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 97.75
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 97.65
KOG0543397 consensus 97.59
KOG1840 508 consensus 97.44
COG4700251 Uncharacterized protein conserved in bacteria containin 97.41
CHL00033165 ycf3 photosystem I assembly protein Ycf3 97.37
KOG4234271 consensus 96.95
pfam04348 535 LppC LppC putative lipoprotein. This family includes se 96.48
KOG1126638 consensus 96.18
KOG0543397 consensus 96.05
KOG0547 606 consensus 95.94
KOG2003 840 consensus 95.84
KOG1125579 consensus 94.96
KOG4648 536 consensus 93.5
KOG4162799 consensus 91.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.68
COG1729262 Uncharacterized protein conserved in bacteria [Function 97.98
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.58
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 97.39
PRK10803262 hypothetical protein; Provisional 96.77
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 96.65
CHL00033165 ycf3 photosystem I assembly protein Ycf3 95.91
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 95.41
COG4649221 Uncharacterized protein conserved in bacteria [Function 97.69
COG4499434 Predicted membrane protein [Function unknown] 97.14
pfam10140359 essB Predicted membrane protein essB. Members of this f 95.9
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 97.5
KOG2076 895 consensus 97.06
pfam09986214 DUF2225 Uncharacterized protein conserved in bacteria ( 93.58
KOG2002 1018 consensus 97.48
PRK10747 398 putative protoheme IX biogenesis protein; Provisional 97.4
KOG2376 652 consensus 97.07
KOG1129478 consensus 95.23
pfam07219134 HemY_N HemY protein N-terminus. This family represents 92.31
pfam0997643 DUF2133 Uncharacterized protein conserved in bacteria ( 97.16
PRK10920 389 putative uroporphyrinogen III C-methyltransferase; Prov 91.63
pfam12072201 DUF3552 Domain of unknown function (DUF3552). This pres 91.44
KOG2003 840 consensus 96.25
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 95.08
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is foun 93.65
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10858 DUF2659 Protein of unknown function (DUF2659) Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>pfam10300 IML2 Putative mitochondrial outer membrane protein Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>pfam09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins) Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>pfam04348 LppC LppC putative lipoprotein Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4499 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam10140 essB Predicted membrane protein essB Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>pfam09986 DUF2225 Uncharacterized protein conserved in bacteria (DUF2225) Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>pfam07219 HemY_N HemY protein N-terminus Back     alignment and domain information
>pfam09976 DUF2133 Uncharacterized protein conserved in bacteria (DUF2133) Back     alignment and domain information
>PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>pfam12072 DUF3552 Domain of unknown function (DUF3552) Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target218 hypothetical protein CLIBASIA_01530 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 5e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 39.6 bits (91), Expect = 5e-04
 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 3/21 (14%)

Query: 113 LKVANDDLAP-LAVRYAATLQ 132
           LK+  DD AP LA++  AT++
Sbjct: 29  LKLYADDSAPALAIK--ATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target218 hypothetical protein CLIBASIA_01530 [Candidatus Liberib
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV pilus 99.03
2vq2_A225 PILW, putative fimbrial biogenesis and twitching motili 98.85
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltr 98.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV pilus 98.82
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 98.81
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, structural 98.77
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chaperone 98.77
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chaperone 98.7
2vq2_A225 PILW, putative fimbrial biogenesis and twitching motili 98.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR motifs 98.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide repe 98.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle 98.68
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltr 98.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-peptid 98.66
3hym_B330 Cell division cycle protein 16 homolog; APC, anaphase p 98.66
2gw1_A514 Mitochondrial precursor proteins import receptor; TPR, 98.65
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mitochond 98.65
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetratricop 98.62
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, protein bi 98.6
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR motifs 98.6
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeats (TP 98.59
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mitochond 98.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG subuni 98.56
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat COAT 98.54
2gw1_A514 Mitochondrial precursor proteins import receptor; TPR, 98.51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaphase p 98.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillus sub 98.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillus sub 98.47
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat COAT 98.46
1qqe_A292 Vesicular transport protein SEC17; helix-turn-helix TPR 98.46
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structural ge 98.43
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeats (TP 98.31
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, structural 98.29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, structural 98.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricopeptide 98.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotein, te 98.12
3gw4_A203 Uncharacterized protein; structural genomics, PSI-2, pr 98.11
3gw4_A203 Uncharacterized protein; structural genomics, PSI-2, pr 98.09
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT domain, 98.09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1.60 98.07
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, struc 98.06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disassembly, 98.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signa 98.01
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix repea 97.96
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 97.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-helix TPR 97.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, protein bi 97.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransferase t 97.74
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protein; 2. 97.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT domain, 97.71
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, prot 97.61
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, 97.58
3n71_A490 Histone lysine methyltransferase SMYD1; heart developme 97.54
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unknown fu 97.52
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; protei 97.19
1pc2_A152 Mitochondria fission protein; unknown function; NMR {Ho 97.16
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricopeptide 97.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Saccharomyce 96.06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT domain, 96.05
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated vesi 95.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT domain, 95.48
1klx_A138 Cysteine rich protein B; structural genomics, helix-tur 95.26
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, alginate bi 95.16
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 98.92
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetratric 98.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, structural 98.58
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, bacte 98.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopeptide, 98.37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2; tet 98.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1.60 98.34
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unknown fu 98.32
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotein, te 98.29
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, h 98.26
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; alph 98.19
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, prot 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, 98.16
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structural ge 98.16
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide repe 98.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, prot 98.07
2hr2_A159 Hypothetical protein; NP_663012.1, structural genomics, 97.96
1pc2_A152 Mitochondria fission protein; unknown function; NMR {Ho 97.95
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signa 97.91
3k9i_A117 BH0479 protein; putative protein binding protein, struc 97.86
2kat_A115 Uncharacterized protein; NESG, structure, structural ge 97.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 97.59
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protein; ch 97.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo 97.52
2kck_A112 TPR repeat; tetratricopeptide repeat, structural genomi 97.49
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protein; 2. 97.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart developme 97.12
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic retic 97.07
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated vesi 96.29
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, tetra 96.07
3pdn_A428 SET and MYND domain-containing protein 3; rossmann fold 94.44
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 98.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, prot 98.28
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protein; ch 98.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetratricop 98.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle 98.0
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetratric 97.91
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, bacte 97.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; alph 97.82
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, h 97.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disassembly, 97.77
2dba_A148 Smooth muscle cell associated protein-1, isoform 2; tet 97.5
2kat_A115 Uncharacterized protein; NESG, structure, structural ge 97.45
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopeptide, 97.26
3k9i_A117 BH0479 protein; putative protein binding protein, struc 97.09
2hr2_A159 Hypothetical protein; NP_663012.1, structural genomics, 96.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural genomi 96.62
2e2e_A177 Formate-dependent nitrite reductase complex NRFG subuni 96.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, 96.34
2pqr_A129 Mitochondria fission 1 protein; TPR domain, protein-pro 94.58
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-peptid 98.6
1hz4_A373 MALT regulatory protein; two-helix bundles, helix repea 98.31
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, 98.16
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Saccharomyce 97.39
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1.55 97.2
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; protei 97.2
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, structur 97.14
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alpha, GF 97.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, structural 96.0
2pqr_A129 Mitochondria fission 1 protein; TPR domain, protein-pro 95.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 98.24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo 98.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1.55 97.05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, structur 96.03
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, struc 94.55
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, tetra 93.95
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransferase t 97.71
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR, tet 96.52
1ouv_A273 Conserved hypothetical secreted protein; TPR repeat, HC 94.2
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alpha, GF 97.36
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransferase t 96.72
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransferase t 95.87
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic retic 95.74
3bee_A93 Putative YFRE protein; putaive YFRE protein, structural 94.79
2kog_A119 Vesicle-associated membrane protein 2; synaptobrevin, V 92.47
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2fi7_A Back     alignment and structure
Probab=99.03  E-value=1.5e-07  Score=63.88  Aligned_cols=141  Identities=21%  Similarity=0.232  Sum_probs=76.1

Q ss_pred             HHHHHHHH-HHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99999999-99984138766699999997312552069999999999995110057789999998731268957899999
Q gi|254780421|r   52 IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT  130 (218)
Q Consensus        52 ~as~~y~~-al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~  130 (218)
                      +..++|.. ++.....+++++|+..|++.++-.|+.  .-+.+.+|.++...|++++|+..|+.+++..+.+.    -+.
T Consensus        35 ~~~day~~Lg~~y~~~g~~~~A~~~~~~al~~~p~~--~~a~~~Lg~~~~~~g~~~~A~~~~~~al~~~p~~~----~~~  108 (252)
T 2ho1_A           35 EARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSS--ADAHAALAVVFQTEMEPKLADEEYRKALASDSRNA----RVL  108 (252)
T ss_dssp             HHHHHHHHHHHHHHHTTCTGGGHHHHHHHHHHCTTC--HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH----HHH
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCC----HHH
T ss_conf             899999999999998599999999999999839998--99999999999986999999999999987299770----788


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHC-CCCCHHH
Q ss_conf             9999963026998999999753114-642356899999999999889989999999999835-5899899
Q gi|254780421|r  131 LQAASILVDTSSYEEISKILQKLSE-PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD-NNSPFGI  198 (218)
Q Consensus       131 l~la~~~~~~~~~d~a~~~l~~~~~-~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~-~~~p~~~  198 (218)
                      +.++.++...+++++++..+..... ...|....++..+|.++.+.|++++|++.|++++.. ++.|...
T Consensus       109 ~~la~~~~~~~~~~eA~~~~~~al~~~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~  178 (252)
T 2ho1_A          109 NNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVA  178 (252)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHTTCTTCTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHH
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             9987889984548999999999998633751146541289998876999999999999998689989999



>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2fi7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCNACYLATION; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, unfolded protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, unfolded protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric regulation, phosphoprotein, TPR repeat; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus HB27} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric regulation, phosphoprotein, TPR repeat; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG subunit; TPR, cytochrome C biogenesis, O157:H7 EDL933, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomics, unkown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics consortium, SGC, coiled coil, microtubule, motor protein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle, cell division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: e.61.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transcription activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCNACYLATION; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2vsn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus HB27} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3c72_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle, cell division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, cytoplasm, plasmid, virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics consortium, SGC, coiled coil, microtubule, motor protein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomics, unkown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; NP_663012.1, structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; 2.54A {Chlorobium tepidum tls} SCOP: a.118.8.8 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint center for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A Back     alignment and structure