255764473

255764473

ornithine carbamoyltransferase

GeneID in NCBI database:8209419Locus tag:CLIBASIA_01590
Protein GI in NCBI database:255764473Protein Accession:YP_003064846.2
Gene range:+(340008, 340928)Protein Length:306aa
Gene description:ornithine carbamoyltransferase
COG prediction:[E] Ornithine carbamoyltransferase
KEGG prediction:argF; ornithine carbamoyltransferase (EC:2.1.3.3)
SEED prediction:Ornithine carbamoyltransferase (EC 2.1.3.3)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
ccccccccccHHHccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHccEEEEEccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHcccccEEEEEcHHHcccccHHHHHHHHHHccccHHHHHHcccccEEEccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc
cccccccEccHHHccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHccEEEEEcccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHccHHHHccEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHccccEEEEEEEEccccHHHHHHHHHccccHHHHHHHHHcccccEEEccccccEcccEcHHHHHcccEcHHHHHHHHHHHHHHHHHHHHccc
mmtypkhfadlsnisssnLSCIIEVAKKIKNssenifenkplsGKVLAMIFekpstrtrVSFEVAMKHLggdtiflsgsemqlgraetIGDTAKVLSRYVDAIVMRTTNHSRLlelteyatvpvinaltdnthpcqIIADIMTFEehrgsvkgklfswsgdgnnILHSLIEGAARFNYLLNIatpigseprneyLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLmsmahpdalfmhclpahrgeevinevldgpqsvvfdeaENRLHTQKAILLWCFGII
mmtypkhfadlsnisssNLSCIIEVAKKiknssenifenkplsgkVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
MMTYPKHFADlsnisssnlsciiEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
***YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK*R*EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
****PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII
MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
254780300316 aspartate carbamoyltransferase catalytic subunit [ 9e-14
>gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Back     alignment
 Score = 68.9 bits (167), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 116/277 (41%), Gaps = 38/277 (13%)

Query: 42  LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY-V 100
           L G     +F + STRT+ SFEVA K LG   I ++     + + E I DT   L+    
Sbjct: 44  LQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRP 103

Query: 101 DAIVMRTTNHSRLLELTEYATVPVINALTDNT--HPCQIIADIMTFEEHRGSVKGKLFSW 158
           + IV+R      +  L      P I    D T  HP Q + D       +G +     + 
Sbjct: 104 NIIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAI 163

Query: 159 SGDGNNILHSLIEGAARFNYLL--------NIATPIGSEPRNEYLNWARNQGASVALFHD 210
            GD   ILHS +   AR + +L         +  PI   P++       N G  V +FHD
Sbjct: 164 CGD---ILHSRV---ARSDIMLLNTMGARIRVIAPITLLPKD-----ISNMG--VEVFHD 210

Query: 211 AVQAVKGAHCVFTDTWISMNQEFKARE--------EHVFQPFQVNLSLMSMAHPDALFMH 262
             + +K    +     + M QE   R         +HV   + ++   +  A  DAL MH
Sbjct: 211 MQKGLKNVDVIM---ILRMQQERIPRSLIPSIREYKHV---YSLDEKKLKYAKKDALVMH 264

Query: 263 CLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAIL 299
             P +R  E+ + V DG QS++  + E  +  + AI+
Sbjct: 265 PGPINRNYEISSSVADGSQSIIQYQVEMGVAVRMAII 301

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
315122119305 ornithine carbamoyltransferase [Candidatus Liberibacter 1 1e-155
222084787305 ornithine carbamoyltransferase protein [Agrobacterium r 1 1e-132
190890220304 ornithine carbamoyltransferase [Rhizobium etli CIAT 652 1 1e-130
327190080304 ornithine carbamoyltransferase [Rhizobium etli CNPAF512 1 1e-130
86356171304 ornithine carbamoyltransferase [Rhizobium etli CFN 42] 1 1e-130
15964271303 ornithine carbamoyltransferase [Sinorhizobium meliloti 1 1e-129
209547785304 ornithine carbamoyltransferase [Rhizobium leguminosarum 1 1e-129
116250322304 ornithine carbamoyltransferase [Rhizobium leguminosarum 1 1e-129
241202940304 ornithine carbamoyltransferase [Rhizobium leguminosarum 1 1e-129
15887776305 ornithine carbamoyltransferase [Agrobacterium tumefacie 1 1e-129
>gi|315122119|ref|YP_004062608.1| ornithine carbamoyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 305 Back     alignment and organism information
 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/304 (86%), Positives = 280/304 (92%)

Query: 2   MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVS 61
           MTY KHF DLS +SSSNLS I+EVAKK KN   N  E KPLSGKVLAMIFEKPSTRTRVS
Sbjct: 1   MTYTKHFLDLSKVSSSNLSLIMEVAKKRKNPLANDLEEKPLSGKVLAMIFEKPSTRTRVS 60

Query: 62  FEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYAT 121
           FEVAMK+LGG+TIFLSGSEMQLGRAETIGDTA+VLSRYVDAIVMRTTNHSRLLEL E+AT
Sbjct: 61  FEVAMKNLGGETIFLSGSEMQLGRAETIGDTARVLSRYVDAIVMRTTNHSRLLELAEHAT 120

Query: 122 VPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLN 181
           VPVINALTDNTHPCQIIAD+MTFEE R SVKGKLFSWSGDGNNIL+SLIEGA RF+Y LN
Sbjct: 121 VPVINALTDNTHPCQIIADVMTFEEVRESVKGKLFSWSGDGNNILNSLIEGAVRFDYRLN 180

Query: 182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVF 241
           IATPIGSEP+ EYLNWARNQGASV LFHDAV+AVK +HCVFTDTW SMNQEF+AREE+VF
Sbjct: 181 IATPIGSEPQGEYLNWARNQGASVVLFHDAVKAVKDSHCVFTDTWTSMNQEFRAREEYVF 240

Query: 242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLW 301
           +PFQVN  LMSMAHPDALFMHCLPAHRG+EV NEVLDGPQSVVFDEAENRLHTQKAILLW
Sbjct: 241 EPFQVNSKLMSMAHPDALFMHCLPAHRGKEVTNEVLDGPQSVVFDEAENRLHTQKAILLW 300

Query: 302 CFGI 305
           CF +
Sbjct: 301 CFDL 304


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084787|ref|YP_002543316.1| ornithine carbamoyltransferase protein [Agrobacterium radiobacter K84] Length = 305 Back     alignment and organism information
>gi|190890220|ref|YP_001976762.1| ornithine carbamoyltransferase [Rhizobium etli CIAT 652] Length = 304 Back     alignment and organism information
>gi|327190080|gb|EGE57196.1| ornithine carbamoyltransferase [Rhizobium etli CNPAF512] Length = 304 Back     alignment and organism information
>gi|86356171|ref|YP_468063.1| ornithine carbamoyltransferase [Rhizobium etli CFN 42] Length = 304 Back     alignment and organism information
>gi|15964271|ref|NP_384624.1| ornithine carbamoyltransferase [Sinorhizobium meliloti 1021] Length = 303 Back     alignment and organism information
>gi|209547785|ref|YP_002279702.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 304 Back     alignment and organism information
>gi|116250322|ref|YP_766160.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 304 Back     alignment and organism information
>gi|241202940|ref|YP_002974036.1| ornithine carbamoyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 304 Back     alignment and organism information
>gi|15887776|ref|NP_353457.1| ornithine carbamoyltransferase [Agrobacterium tumefaciens str. C58] Length = 305 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase; Pro 1e-145
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase 1e-109
PLN02342348 PLN02342, PLN02342, ornithine carbamoyltransferase 2e-98
PRK02102331 PRK02102, PRK02102, ornithine carbamoyltransferase; Val 3e-85
KOG1504346 KOG1504, KOG1504, KOG1504, Ornithine carbamoyltransfera 1e-78
PRK02255338 PRK02255, PRK02255, putrescine carbamoyltransferase; Pr 8e-75
PRK14805302 PRK14805, PRK14805, ornithine carbamoyltransferase; Pro 7e-74
PRK04284332 PRK04284, PRK04284, ornithine carbamoyltransferase; Pro 3e-62
PRK03515336 PRK03515, PRK03515, ornithine carbamoyltransferase subu 6e-60
PRK12562334 PRK12562, PRK12562, ornithine carbamoyltransferase subu 4e-54
PRK01713334 PRK01713, PRK01713, ornithine carbamoyltransferase; Pro 2e-48
PRK04523335 PRK04523, PRK04523, N-acetylornithine carbamoyltransfer 8e-48
PRK14804311 PRK14804, PRK14804, ornithine carbamoyltransferase; Pro 3e-44
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, catalyti 6e-41
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase catalyti 9e-41
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase 4e-38
TIGR03316357 TIGR03316, ygeW, probable carbamoyltransferase YgeW 9e-32
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 2e-22
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase catalyti 8e-13
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Amino ac 1e-114
pfam02729140 pfam02729, OTCace_N, Aspartate/ornithine carbamoyltrans 3e-50
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase; Pro 1e-15
pfam00185155 pfam00185, OTCace, Aspartate/ornithine carbamoyltransfe 1e-41
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase; Pro 3e-20
PRK07200395 PRK07200, PRK07200, aspartate/ornithine carbamoyltransf 5e-11
>gnl|CDD|179122 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|177976 PLN02342, PLN02342, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|179366 PRK02102, PRK02102, ornithine carbamoyltransferase; Validated Back     alignment and domain information
>gnl|CDD|36717 KOG1504, KOG1504, KOG1504, Ornithine carbamoyltransferase OTC/ARG3 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179396 PRK02255, PRK02255, putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184827 PRK14805, PRK14805, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|167776 PRK04284, PRK04284, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179587 PRK03515, PRK03515, ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|105755 PRK12562, PRK12562, ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|167263 PRK01713, PRK01713, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179858 PRK04523, PRK04523, N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|173265 PRK14804, PRK14804, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30886 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179144 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|161989 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|132359 TIGR03316, ygeW, probable carbamoyltransferase YgeW Back     alignment and domain information
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|30427 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|145728 pfam02729, OTCace_N, Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|143948 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180878 PRK07200, PRK07200, aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 306 ornithine carbamoyltransferase [Candidatus Liberibacter
TIGR00658341 orni_carb_tr ornithine carbamoyltransferase; InterPro: 100.0
PRK00779308 ornithine carbamoyltransferase; Provisional 100.0
PRK02255341 putrescine carbamoyltransferase; Provisional 100.0
PRK02102331 ornithine carbamoyltransferase; Validated 100.0
PRK03515334 ornithine carbamoyltransferase subunit I; Provisional 100.0
PRK12562334 ornithine carbamoyltransferase subunit F; Provisional 100.0
PRK04284332 ornithine carbamoyltransferase; Provisional 100.0
PRK08192338 aspartate carbamoyltransferase; Provisional 100.0
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid transpo 100.0
PRK00856304 pyrB aspartate carbamoyltransferase catalytic subunit; 100.0
PRK01713334 ornithine carbamoyltransferase; Provisional 100.0
TIGR00670336 asp_carb_tr aspartate carbamoyltransferase; InterPro: I 100.0
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members of thi 100.0
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subunit; 100.0
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 100.0
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic chain [N 100.0
PRK07200395 aspartate/ornithine carbamoyltransferase family protein 100.0
PRK11891430 aspartate carbamoyltransferase; Provisional 100.0
KOG1504346 consensus 100.0
PRK13376 524 pyrB bifunctional aspartate carbamoyltransferase cataly 100.0
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 95.38
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 91.66
pfam02729140 OTCace_N Aspartate/ornithine carbamoyltransferase, carb 100.0
pfam00185155 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Or 100.0
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 91.56
PRK00045 429 hemA glutamyl-tRNA reductase; Reviewed 90.42
PRK00257 379 erythronate-4-phosphate dehydrogenase; Validated 97.55
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 96.62
PRK08605332 D-lactate dehydrogenase; Validated 96.51
PRK13243333 glyoxylate reductase; Reviewed 96.5
PRK06932314 glycerate dehydrogenase; Provisional 96.36
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 96.21
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.1
PRK07574385 formate dehydrogenase; Provisional 96.02
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 95.69
PRK06487317 glycerate dehydrogenase; Provisional 95.48
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 96.73
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 90.82
PRK12480330 D-lactate dehydrogenase; Provisional 95.0
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.28
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 93.58
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 94.85
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 91.67
PRK06436303 glycerate dehydrogenase; Provisional 93.88
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 91.03
TIGR00407415 proA gamma-glutamyl phosphate reductase; InterPro: IPR0 90.26
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase; InterPro: IPR002292 The ornithine carbamoyltransferases are a family of enzymes that catalyse the production of citrulline from carbamoyl-phosphate and ornithine Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase; InterPro: IPR002082 Aspartate carbamoyltransferase (ATCase) catalyses the formation of carbamoyl-aspartate in the pyrimidine biosynthesis pathway, by the association of aspartate and carbamoyl-phosphate Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>KOG1504 consensus Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>pfam02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain Back     alignment and domain information
>pfam00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase; InterPro: IPR000965 Gamma-glutamyl phosphate reductase (1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
1a1s_A314 Ornithine Carbamoyltransferase From Pyrococcus Furi 1e-60
1pvv_A315 Refined Structure Of Pyrococcus Furiosus Ornithine 3e-60
2i6u_A307 Crystal Structure Of Ornithine Carbamoyltransferase 9e-50
1akm_A333 Ornithine Transcarbamylase From Escherichia Coli Le 7e-49
2otc_A333 Ornithine Transcarbamoylase Complexed With N- (Phos 7e-49
1ml4_A308 The Pala-Liganded Aspartate Transcarbamoylase Catal 1e-47
2ef0_A301 Crystal Structure Of Ornithine Carbamoyltransferase 2e-47
1oth_A321 Crystal Structure Of Human Ornithine Transcarbamoyl 1e-45
1vlv_A325 Crystal Structure Of Ornithine Carbamoyltransferase 2e-45
1fb5_A320 Low Resolution Structure Of Ovine Ornithine Transca 2e-44
2at2_A300 Molecular Structure Of Bacillus Subtilis Aspartate 6e-44
3gd5_A323 Crystal Structure Of Ornithine Carbamoyltransferase 5e-43
1ort_A335 Ornithine Transcarbamoylase From Pseudomonas Aerugi 6e-43
1dxh_A335 Catabolic Ornithine Carbamoyltransferase From Pseud 8e-43
2w37_A359 Crystal Structure Of The Hexameric Catabolic Ornith 4e-42
3mpu_A310 Crystal Structure Of The C47aA241C DISULFIDE-Linked 6e-42
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 7e-42
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 8e-42
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 8e-42
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 9e-42
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 2e-41
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 2e-41
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 2e-41
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 2e-41
9atc_A310 Atcase Y165f Mutant Length = 310 2e-41
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 2e-41
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 5e-41
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 7e-41
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 2e-40
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 3e-40
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 3e-39
2be9_A300 Crystal Structure Of The Ctp-Liganded (T-State) Asp 9e-37
1pg5_A299 Crystal Structure Of The Unligated (T-State) Aspart 1e-36
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 1e-36
3grf_A328 X-Ray Structure Of Ornithine Transcarbamoylase From 3e-34
3m5c_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 4e-34
3d6n_B291 Crystal Structure Of Aquifex Dihydroorotase Activat 7e-33
2g68_A359 Crystal Structure Of X. Campestris N-Acetylornithin 9e-33
2g6a_A359 Crystal Structure Of X. Campestris N-Acetylornithin 1e-32
1zq2_A359 Crystal Structure Of Acetylornithine Transcarbamyla 1e-32
2g6c_A359 Crystal Structure Of X. Campestris N-Acetylornithin 1e-32
2g65_A359 Crystal Structure Of X. Campestris N-Acetylornithin 1e-32
3l04_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 1e-32
3l05_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
3kzc_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
3l06_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
3l02_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
3m5d_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
3m4n_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-32
2fg6_X338 N-Succinyl-L-Ornithine Transcarbamylase From B. Fra 4e-20
2g7m_X338 Crystal Structure Of B. Fragilis N-Succinylornithin 4e-20
1js1_X324 Crystal Structure Of A New Transcarbamylase From Th 6e-20
3q98_A399 Structure Of Ygew Encoded Protein From E. Coli Leng 5e-10
>gi|157829642|pdb|1A1S|A Chain A, Ornithine Carbamoyltransferase From Pyrococcus Furiosus Length = 314 Back     alignment and structure
 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (1%)

Query: 6   KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVA 65
           +    L + ++  +  I+E AK  K   +    ++ L GK LAMIF+KPSTRTRVSFEVA
Sbjct: 7   RDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVA 66

Query: 66  MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVI 125
           M HLGG  ++L+  ++QL R ETI DTA+VLSRYVDAI+ R  +H  + +L +YATVPVI
Sbjct: 67  MAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVI 126

Query: 126 NALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP 185
           N L+D +HPCQ +AD MT  E +G++KG    + GDGNN+ HSL+    +    + +ATP
Sbjct: 127 NGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATP 186

Query: 186 IGSEPRNEYLNWARNQGAS----VALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REEHV 240
            G EP  + + WA    A       L HD V+AVK A  ++TD W SM QE +A     +
Sbjct: 187 EGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKI 246

Query: 241 FQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL 300
           F+PFQVN  L+  A PD +FMHCLPAHRGEEV ++V+D P SVV+D+AENRLH QKA+L 
Sbjct: 247 FRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLA 306

Query: 301 WCFG 304
              G
Sbjct: 307 LVMG 310


gi|40889330|pdb|1PVV|A Chain A, Refined Structure Of Pyrococcus Furiosus Ornithine Carbamoyltransferase At 1.87 A Length = 315 Back     alignment and structure
>gi|151567659|pdb|2I6U|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase Complexed With Carbamoyl Phosphate And L-Norvaline From Mycobacterium Tuberculosis (Rv1656) At 2.2 A Length = 307 Back     alignment and structure
>gi|3212448|pdb|1AKM|A Chain A, Ornithine Transcarbamylase From Escherichia Coli Length = 333 Back     alignment and structure
>gi|3318807|pdb|2OTC|A Chain A, Ornithine Transcarbamoylase Complexed With N- (Phosphonacetyl)-L-Ornithine Length = 333 Back     alignment and structure
gi|28948651|pdb|1ML4|A Chain A, The Pala-Liganded Aspartate Transcarbamoylase Catalytic Subunit From Pyrococcus Abyssi Length = 308 Back     alignment and structure
gi|146387442|pdb|2EF0|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Thermus Thermophilus Length = 301 Back     alignment and structure
>gi|6137343|pdb|1OTH|A Chain A, Crystal Structure Of Human Ornithine Transcarbamoylase Complexed With N-Phosphonacetyl-L-Ornithine Length = 321 Back     alignment and structure
>gi|55670454|pdb|1VLV|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase (Tm1097) From Thermotoga Maritima At 2.25 A Resolution Length = 325 Back     alignment and structure
gi|34810173|pdb|1FB5|A Chain A, Low Resolution Structure Of Ovine Ornithine Transcarbmoylase In The Unliganded State Length = 320 Back     alignment and structure
>gi|494729|pdb|2AT2|A Chain A, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300 Back     alignment and structure
>gi|226887854|pdb|3GD5|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Gloeobacter Violaceus Length = 323 Back     alignment and structure
>gi|1943014|pdb|1ORT|A Chain A, Ornithine Transcarbamoylase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>gi|13096652|pdb|1DXH|A Chain A, Catabolic Ornithine Carbamoyltransferase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>gi|268612125|pdb|2W37|A Chain A, Crystal Structure Of The Hexameric Catabolic Ornithine Transcarbamylase From Lactobacillus Hilgardii Length = 359 Back     alignment and structure
>gi|301015943|pdb|3MPU|A Chain A, Crystal Structure Of The C47aA241C DISULFIDE-Linked E. Coli Aspartate Transcarbamoylase Holoenzyme Length = 310 Back     alignment and structure
>gi|47169156|pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>gi|494498|pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>gi|6980786|pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl- L-Aspartate (Pala) Length = 310 Back     alignment and structure
>gi|118137347|pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure
gi|8569590|pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>gi|78101178|pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
>gi|67463870|pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
gi|209447313|pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure
>gi|5822587|pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>gi|229685|pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>gi|14278212|pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>gi|51247732|pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>gi|11513487|pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>gi|229664|pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>gi|291191348|pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>gi|118137353|pdb|2BE9|A Chain A, Crystal Structure Of The Ctp-Liganded (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 300 Back     alignment and structure
>gi|49258477|pdb|1PG5|A Chain A, Crystal Structure Of The Unligated (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 299 Back     alignment and structure
>gi|640095|pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure
>gi|242556558|pdb|3GRF|A Chain A, X-Ray Structure Of Ornithine Transcarbamoylase From Giardia Lamblia Length = 328 Back     alignment and structure
>gi|301598567|pdb|3M5C|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302e Mutant Complexed With Palao Length = 359 Back     alignment and structure
gi|221046674|pdb|3D6N|B Chain B, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 291 Back     alignment and structure
>gi|292659726|pdb|3L04|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92p Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|292659727|pdb|3L05|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92s Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|292659720|pdb|3KZC|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase Length = 359 Back     alignment and structure
>gi|292659728|pdb|3L06|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92v Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|292659725|pdb|3L02|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92a Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>gi|301598568|pdb|3M5D|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302r Mutant Complexed With Palao Length = 359 Back     alignment and structure
>gi|301598550|pdb|3M4N|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302a Mutant Complexed With Palao Length = 359 Back     alignment and structure
>gi|109157615|pdb|2FG6|X Chain X, N-Succinyl-L-Ornithine Transcarbamylase From B. Fragilis Complexed With Sulfate And N-Succinyl-L-Norvaline Length = 338 Back     alignment and structure
>gi|134104373|pdb|2G7M|X Chain X, Crystal Structure Of B. Fragilis N-Succinylornithine Transcarbamylase P90e Mutant Complexed With Carbamoyl Phosphate And N-Acetylnorvaline Length = 338 Back     alignment and structure
>gi|22218872|pdb|1JS1|X Chain X, Crystal Structure Of A New Transcarbamylase From The Anaerobic Bacterium Bacteroides Fragilis At 2.0 A Resolution Length = 324 Back     alignment and structure
>gi|332138218|pdb|3Q98|A Chain A, Structure Of Ygew Encoded Protein From E. Coli Length = 399 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 2.50A 1e-88
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 1.87 3e-88
1js1_X324 Transcarbamylase; alpha/beta topology, two domains, tra 2e-75
1oth_A321 Protein (ornithine transcarbamoylase); transferase; HET 3e-74
3grf_A328 Ornithine carbamoyltransferase; ornithine transcarbamoy 2e-72
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, protei 2e-71
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, pores 1e-70
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta two- 1e-69
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural geno 1e-67
2w37_A359 Ornithine carbamoyltransferase, catabolic; transcarbamy 2e-66
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus acido 1e-64
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, structural ge 9e-64
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crystallo 1e-61
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, structu 3e-59
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhibitor 2e-54
2at2_A300 Aspartate carbamoyltransferase; 3.00A {Bacillus subtili 5e-53
3csu_A310 Protein (aspartate carbamoyltransferase); transferase ( 8e-52
2rgw_A306 Aspartate carbamoyltransferase; aspartate transcarbamoy 2e-47
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Length = 335 Back     alignment and structure
 Score =  321 bits (824), Expect = 1e-88
 Identities = 111/329 (33%), Positives = 174/329 (52%), Gaps = 28/329 (8%)

Query: 4   YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFE 63
           + ++   L + S+  L  ++++++ +K +     E + L  K +A+IFEK STRTR +FE
Sbjct: 5   HNRNLLSLMHHSTRELRYLLDLSRDLKRAKYTGTEQQHLKRKNIALIFEKTSTRTRCAFE 64

Query: 64  VAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP 123
           VA    G +  ++  +  Q+G  E++ DTA+VL R  DAI  R      + EL ++A VP
Sbjct: 65  VAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAKFAGVP 124

Query: 124 VINALTDNTHPCQIIADIMTFEEHRG-SVKGKLFSWSGDG-NNILHSLIEGAARFNYLLN 181
           V N LTD  HP Q++AD++T  EH    +    +++ GD  NN+ +SL+   A+    + 
Sbjct: 125 VFNGLTDEYHPTQMLADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKLGMDVR 184

Query: 182 IATPIGSEPRNEYLNWARNQ----GASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE 237
           IA P    P +E++   +      GA + L  D  +AVKG   V TD W+SM +  +A  
Sbjct: 185 IAAPKALWPHDEFVAQCKKFAEESGAKLTLTEDPKEAVKGVDFVHTDVWVSMGEPVEAWG 244

Query: 238 E--HVFQPFQVNLSLM-SMAHPDALFMHCLPAH-------------------RGEEVINE 275
           E      P+QVN+ +M +  +P A FMHCLPA                     G EV  +
Sbjct: 245 ERIKELLPYQVNMEIMKATGNPRAKFMHCLPAFHNSETKVGKQIAEQYPNLANGIEVTED 304

Query: 276 VLDGPQSVVFDEAENRLHTQKAILLWCFG 304
           V + P ++ F++AENR+HT KAIL+    
Sbjct: 305 VFESPYNIAFEQAENRMHTIKAILVSTLA 333


>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Length = 324 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal- binding, pyrimidine biosynthesis, zinc; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis; 2.10A {Gloeobacter violaceus pcc 7421} Length = 323 Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Length = 359 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus HB8} Length = 301 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Length = 325 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Length = 333 Back     alignment and structure
>2at2_A Aspartate carbamoyltransferase; 3.00A {Bacillus subtilis} SCOP: c.78.1.1 c.78.1.1 Length = 300 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli K12} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
>2rgw_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, pyrimidine biosynthesis, thermostability; 2.80A {Methanococcus jannaschii} PDB: 3e2p_A Length = 306 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target306 ornithine carbamoyltransferase [Candidatus Liberibacter
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 1.87 100.0
2w37_A359 Ornithine carbamoyltransferase, catabolic; transcarbamy 100.0
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, protei 100.0
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural geno 100.0
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhibitor 100.0
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, structu 100.0
1oth_A321 Protein (ornithine transcarbamoylase); transferase; HET 100.0
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crystallo 100.0
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 2.50A 100.0
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, structural ge 100.0
3grf_A328 Ornithine carbamoyltransferase; ornithine transcarbamoy 100.0
2rgw_A306 Aspartate carbamoyltransferase; aspartate transcarbamoy 100.0
3csu_A310 Protein (aspartate carbamoyltransferase); transferase ( 100.0
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus acido 100.0
1js1_X324 Transcarbamylase; alpha/beta topology, two domains, tra 100.0
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta two- 100.0
2at2_A300 Aspartate carbamoyltransferase; 3.00A {Bacillus subtili 100.0
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, pores 100.0
3p2o_A285 Bifunctional protein fold; structural genomics, center 96.59
3l07_A285 Bifunctional protein fold; structural genomics, IDP0184 95.14
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenyltetrah 95.12
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyltetra 94.64
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 96.58
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 96.36
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural genom 96.33
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear protein, p 96.28
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 96.18
3kbo_A315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 96.1
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 95.85
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 95.67
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 95.51
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 95.51
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 95.47
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 95.4
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural genomics 95.26
3evt_A324 Phosphoglycerate dehydrogenase; structural genomics, PS 95.14
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 94.88
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 94.83
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 94.56
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 93.96
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 93.32
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 93.09
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 92.9
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 92.79
1b0a_A288 Protein (fold bifunctional protein); folate, dehydrogen 95.7
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, structura 95.49
2rir_A300 Dipicolinate synthase, A chain; structural genomics, AP 95.38
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 95.22
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; structura 94.55
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 94.05
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 94.97
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cob 91.4
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, national pr 90.39
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, structur 92.54
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, dime 92.44
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor complex, hy 91.71
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genomics, 92.41
3l49_A291 ABC sugar (ribose) transporter, periplasmic substrate-b 91.64
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hydrolas 90.49
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
Probab=100.00  E-value=0  Score=653.04  Aligned_cols=305  Identities=50%  Similarity=0.809  Sum_probs=286.7

Q ss_pred             CCC-CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             988-8771784458999999999999999966523666544379879999428883578999989863475433332100
Q gi|255764473|r    2 MTY-PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus         2 m~~-~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~   80 (306)
                      |+. +||||+++||++++|..||++|..+|..++++...+.|+||+++++|||||||||+|||+|+++|||+++++++.+
T Consensus         3 ~~l~gk~ll~i~dls~~~i~~ll~~A~~lk~~~~~~~~~~~L~gk~v~llF~epSTRTR~SFe~A~~~LG~~vi~~~~~~   82 (315)
T 1pvv_A            3 VSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQD   82 (315)
T ss_dssp             CCCTTCCBSCGGGSCHHHHHHHHHHHHHHHHHHHHTCCCCTTTTCEEEEEESSCCSHHHHHHHHHHHHTTSEEEEEEGGG
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             88889982751118999999999999999877645897633699989998448973058999999997699543204222


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             00123210799999753001011121013200677630124412404333202467876557664200133677304610
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSG  160 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vG  160 (306)
                      ||++||||++||++++++|+|+||+||++++.+.++++++++|||||+++++||||+|+|+|||+|++|.++|++|+|+|
T Consensus        83 ss~~kgEs~~Dt~~~ls~y~D~iviR~~~~~~~~~~a~~s~vPVINg~~~~~HPtQaL~Dl~Ti~e~~g~~~~l~i~~vG  162 (315)
T 1pvv_A           83 LQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVG  162 (315)
T ss_dssp             STTTTTCCHHHHHHHHTTTCSEEEEECSSHHHHHHHHHHCSSCEEEEECSSCCHHHHHHHHHHHHHHHSCCTTCEEEEES
T ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             34778860989999975258878886057106999998679988969998646778987678999872875687799967


Q ss_pred             CCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH----CCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCH-H
Q ss_conf             455554310100123312576520000132100002432----01332221366466306873322210000002201-3
Q gi|255764473|r  161 DGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK-A  235 (306)
Q Consensus       161 d~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~----~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~-~  235 (306)
                      |++||+||++.++++||+++++++|+++.|++..+++++    ..|.++.+++|+.++++++|+||+++|.+++++.. .
T Consensus       163 d~~~v~~S~~~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~~~~~~~~i~~~~d~~~a~~~aDvvyt~~~~~~~~~~~~~  242 (315)
T 1pvv_A          163 DGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAE  242 (315)
T ss_dssp             CCCHHHHHHHHHHHHTTCEEEEECCTTCCCCHHHHHHHHHHHHHHTCEEEEESCHHHHTTTCSEEEECCCCCSSTTSSSS
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEHHHHHCCCCCCHH
T ss_conf             87531568999999841878998898668868999999999987198599976999985579999541887646610259


Q ss_pred             HHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             33100111233688996289872992599987487357679679971068687755999999999962559
Q gi|255764473|r  236 REEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII  306 (306)
Q Consensus       236 ~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~~  306 (306)
                      +...++.+||+|.++|+.++++++||||||+|||+||+++|+++|+|+||+||+||+|+|||||+++||-|
T Consensus       243 ~~~~~~~~~~l~~~~l~~~~~~~i~mHplP~~Rg~Ei~~~v~~~~~s~~~~Qa~Ngl~vrmAlL~~~lgg~  313 (315)
T 1pvv_A          243 ERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGI  313 (315)
T ss_dssp             HHHHHHGGGCBCHHHHHTSCTTCEEEECSCCCBTTTBCHHHHTSTTBCHHHHHHHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99987763563399994489998998999987887008888669977699999701999999999997688



>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis; 2.10A {Gloeobacter violaceus pcc 7421} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>2rgw_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, pyrimidine biosynthesis, thermostability; 2.80A {Methanococcus jannaschii} PDB: 3e2p_A Back     alignment and structure