254780434

254780434

dihydroorotate dehydrogenase 2

GeneID in NCBI database:8209420Locus tag:CLIBASIA_01595
Protein GI in NCBI database:254780434Protein Accession:YP_003064847.1
Gene range:+(341066, 342154)Protein Length:362aa
Gene description:dihydroorotate dehydrogenase 2
COG prediction:[F] Dihydroorotate dehydrogenase
KEGG prediction:pyrD; dihydroorotate dehydrogenase 2 (EC:1.3.3.1); K00226 dihydroorotate oxidase [EC:1.3.3.1]
SEED prediction:Dihydroorotate dehydrogenase (EC 1.3.3.1)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
cHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccEEEEccEEcccccEEcccccccHHHHHHHHHccccEEEEccccHHHcccccccEEEEEccccccccccccccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccccEEEEEHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHccccccHHHccc
cHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccHcccccccHHHHHHHHHccccEEEEcccccccccccccccEEccccHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHccEEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEccEcccccccccccHHHccccccccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcccEEEEEEHHHccccHHHHHHHHHHHHHHHHcccccHHHHHccccHHHccccc
MLSILHKLALrglthldpeiAHHLSIVALKSGllsffpvhsdprlntkvagislsnplgmaagydknaeVPIELLKLGfgfveigtvtphpqagnprprvfrltKDRAIINKlgfnnagyHTVFSRlskiqptspiginlgankdskdFILDYVSGIRLFFTIASYFTinisspntpglrslqKKKNLERLLIHVMQTREeekiktgkfvpiflkispdlseeeLDDIAVEVLSHKVEGIIVSnttlsrkgvqcsdnheqdgglsgsplfLKSTIALAKIRQrvgpkiaiigtggisstKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTvtphpqagnprprVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINIsspntpglrslqKKKNLERLLIHVMqtreeekiktgkfvpIFLKISPDLSEEELDDIAVEVLSHKVEGIivsnttlsrkgvQCSDNHEqdgglsgspLFLKSTIALAKIrqrvgpkiaiigtggissTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLnkenevnfenirgsyteywakkev
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAiigtggisstKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
***ILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQT*E******GKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRK*************LSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKK**
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWA*K**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV
MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target362 dihydroorotate dehydrogenase 2 [Candidatus Liberibacter
315122118339 dihydroorotate dehydrogenase 2 [Candidatus Liberibacter 1 1e-155
222084799362 dihydroorotate oxidase [Agrobacterium radiobacter K84] 1 1e-120
209547802362 dihydroorotate dehydrogenase [Rhizobium leguminosarum b 1 1e-119
116250343362 dihydroorotate dehydrogenase 2 [Rhizobium leguminosarum 1 1e-118
241202976362 dihydroorotate dehydrogenase 2 [Rhizobium leguminosarum 1 1e-118
15964302362 dihydroorotate dehydrogenase 2 [Sinorhizobium meliloti 1 1e-118
307307038362 dihydroorotate dehydrogenase [Sinorhizobium meliloti BL 1 1e-117
307320118362 dihydroorotate dehydrogenase [Sinorhizobium meliloti AK 1 1e-117
86356193362 dihydroorotate dehydrogenase 2 [Rhizobium etli CFN 42] 1 1e-117
190890237362 dihydroorotate dehydrogenase [Rhizobium etli CIAT 652] 1 1e-116
>gi|315122118|ref|YP_004062607.1| dihydroorotate dehydrogenase 2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 339 Back     alignment and organism information
 Score =  551 bits (1420), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/339 (79%), Positives = 304/339 (89%)

Query: 24  LSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVE 83
           +SI+ALKSGLLSFFP+HSD RLNTKVAGIS  NPLGMAAGYDKNAEVP+ELLKLGFGFVE
Sbjct: 1   MSIIALKSGLLSFFPIHSDFRLNTKVAGISFPNPLGMAAGYDKNAEVPMELLKLGFGFVE 60

Query: 84  IGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGAN 143
           +GT+TP+PQ GNP PRVFRL KD+AIIN+LGFNN G +  FSRLSK+Q +SPIG+N+GAN
Sbjct: 61  VGTITPNPQDGNPPPRVFRLIKDQAIINQLGFNNEGSYAAFSRLSKMQTSSPIGVNIGAN 120

Query: 144 KDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEK 203
           KDSKDFI+DYV GIR FFTIASYFTINISSPNTPGLR LQK++NLE+LL  VMQTREEE 
Sbjct: 121 KDSKDFIMDYVYGIRQFFTIASYFTINISSPNTPGLRHLQKRQNLEKLLTRVMQTREEEI 180

Query: 204 IKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGG 263
           IKTGK VPIFLKISPDLSEEELDDIA E +SHKVEG++VSNTTLSR+G+Q S N E+ GG
Sbjct: 181 IKTGKSVPIFLKISPDLSEEELDDIATEAISHKVEGLVVSNTTLSREGLQDSLNKEKIGG 240

Query: 264 LSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG 323
           LSGSPLFLKSTI LAK+RQRVG K+ IIGTGG+SST+DAL+KIMAGANLIQLYSAM+Y G
Sbjct: 241 LSGSPLFLKSTIILAKMRQRVGSKMVIIGTGGVSSTEDALEKIMAGANLIQLYSAMVYGG 300

Query: 324 ISLPKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKEV 362
           ISLPK II+G S FL+KE + + E+IRGS TEYWAKKEV
Sbjct: 301 ISLPKSIIKGFSHFLDKEKKKSLEDIRGSRTEYWAKKEV 339


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084799|ref|YP_002543328.1| dihydroorotate oxidase [Agrobacterium radiobacter K84] Length = 362 Back     alignment and organism information
>gi|209547802|ref|YP_002279719.1| dihydroorotate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 362 Back     alignment and organism information
>gi|116250343|ref|YP_766181.1| dihydroorotate dehydrogenase 2 [Rhizobium leguminosarum bv. viciae 3841] Length = 362 Back     alignment and organism information
>gi|241202976|ref|YP_002974072.1| dihydroorotate dehydrogenase 2 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 362 Back     alignment and organism information
>gi|15964302|ref|NP_384655.1| dihydroorotate dehydrogenase 2 [Sinorhizobium meliloti 1021] Length = 362 Back     alignment and organism information
>gi|307307038|ref|ZP_07586777.1| dihydroorotate dehydrogenase [Sinorhizobium meliloti BL225C] Length = 362 Back     alignment and organism information
>gi|307320118|ref|ZP_07599538.1| dihydroorotate dehydrogenase [Sinorhizobium meliloti AK83] Length = 362 Back     alignment and organism information
>gi|86356193|ref|YP_468085.1| dihydroorotate dehydrogenase 2 [Rhizobium etli CFN 42] Length = 362 Back     alignment and organism information
>gi|190890237|ref|YP_001976779.1| dihydroorotate dehydrogenase [Rhizobium etli CIAT 652] Length = 362 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target362 dihydroorotate dehydrogenase 2 [Candidatus Liberibacter
PRK05286344 PRK05286, PRK05286, dihydroorotate dehydrogenase 2; Rev 1e-127
PLN02826409 PLN02826, PLN02826, dihydroorotate dehydrogenase 4e-93
KOG1436398 KOG1436, KOG1436, KOG1436, Dihydroorotate dehydrogenase 6e-89
TIGR01036335 TIGR01036, pyrD_sub2, dihydroorotate dehydrogenase, sub 2e-88
KOG1799471 KOG1799, KOG1799, KOG1799, Dihydropyrimidine dehydrogen 9e-15
cd04738327 cd04738, DHOD_2_like, Dihydroorotate dehydrogenase (DHO 1e-116
COG0167310 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucleotide 1e-75
pfam01180290 pfam01180, DHO_dh, Dihydroorotate dehydrogenase 2e-67
cd02810289 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (D 1e-41
cd04740296 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DH 1e-24
PRK07259301 PRK07259, PRK07259, dihydroorotate dehydrogenase 1B; Re 9e-20
TIGR01037300 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydrogenase 2e-16
cd04741294 cd04741, DHOD_1A_like, Dihydroorotate dehydrogenase (DH 1e-14
cd02940299 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHP 1e-13
PRK02506310 PRK02506, PRK02506, dihydroorotate dehydrogenase 1A; Re 2e-12
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenase sub 7e-04
PLN02495385 PLN02495, PLN02495, oxidoreductase, acting on the CH-CH 7e-10
cd04739325 cd04739, DHOD_like, Dihydroorotate dehydrogenase (DHOD) 8e-06
PRK07565334 PRK07565, PRK07565, dihydroorotate dehydrogenase 2; Rev 3e-05
PRK02506310 PRK02506, PRK02506, dihydroorotate dehydrogenase 1A; Re 1e-05
cd02809299 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologo 3e-04
pfam01070301 pfam01070, FMN_dh, FMN-dependent dehydrogenase 5e-04
>gnl|CDD|179992 PRK05286, PRK05286, dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>gnl|CDD|178421 PLN02826, PLN02826, dihydroorotate dehydrogenase Back     alignment and domain information
>gnl|CDD|36649 KOG1436, KOG1436, KOG1436, Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130108 TIGR01036, pyrD_sub2, dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>gnl|CDD|37010 KOG1799, KOG1799, KOG1799, Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|73400 cd04738, DHOD_2_like, Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>gnl|CDD|30516 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|144683 pfam01180, DHO_dh, Dihydroorotate dehydrogenase Back     alignment and domain information
>gnl|CDD|73372 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|73402 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>gnl|CDD|180909 PRK07259, PRK07259, dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>gnl|CDD|130109 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>gnl|CDD|73403 cd04741, DHOD_1A_like, Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>gnl|CDD|73382 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|179435 PRK02506, PRK02506, dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>gnl|CDD|181383 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|178112 PLN02495, PLN02495, oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>gnl|CDD|73401 cd04739, DHOD_like, Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>gnl|CDD|181033 PRK07565, PRK07565, dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>gnl|CDD|179435 PRK02506, PRK02506, dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>gnl|CDD|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>gnl|CDD|144604 pfam01070, FMN_dh, FMN-dependent dehydrogenase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 362 dihydroorotate dehydrogenase 2 [Candidatus Liberibacter
TIGR01036370 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 D 100.0
PRK05286336 dihydroorotate dehydrogenase 2; Reviewed 100.0
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 100.0
KOG1436398 consensus 100.0
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 99.75
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 99.75
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 99.73
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 99.68
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 99.67
PRK11197381 lldD L-lactate dehydrogenase; Provisional 99.67
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 99.57
KOG0538363 consensus 99.38
TIGR02708368 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem 99.27
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 100.0
TIGR01037308 pyrD_sub1_fam dihydroorotate dehydrogenase family prote 100.0
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 100.0
PRK02506308 dihydroorotate dehydrogenase 1A; Reviewed 100.0
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 100.0
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 100.0
PRK08318413 dihydropyrimidine dehydrogenase; Validated 100.0
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 100.0
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 100.0
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 100.0
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 100.0
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 100.0
KOG1799471 consensus 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.77
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 99.76
TIGR00737336 nifR3_yhdG putative TIM-barrel protein, nifR3 family; I 99.73
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 99.72
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosomal st 99.66
TIGR02151349 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ 99.65
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 99.51
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 99.5
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.49
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a 99.48
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 99.47
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 99.46
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 99.46
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 99.42
pfam00724336 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase 99.41
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 99.38
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme fam 99.35
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and h 99.3
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 99.29
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 99.28
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 99.22
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 99.18
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN bind 99.12
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 99.08
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 98.8
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 98.78
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 98.7
PRK03220257 consensus 98.68
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 98.66
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 98.65
PRK13129267 consensus 98.62
PRK13115269 consensus 98.6
PRK02145257 consensus 98.57
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 98.57
PRK02621254 consensus 98.57
PRK01659252 consensus 98.55
PRK00830273 consensus 98.55
PRK04281254 consensus 98.52
PRK02747257 consensus 98.51
PRK05211248 consensus 98.49
PRK13118269 consensus 98.46
PRK13119261 consensus 98.43
PRK13113263 consensus 98.4
PRK13122242 consensus 98.37
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 98.1
PRK13131257 consensus 97.9
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735312 hisF imidazoleglycerol phosphate synthase, cyclase subu 97.77
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 97.39
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 97.24
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 97.15
PRK00230231 orotidine 5'-phosphate decarboxylase; Reviewed 97.02
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuraminate l 97.02
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 96.89
TIGR01163216 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 96.88
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate trans 96.87
pfam00701289 DHDPS Dihydrodipicolinate synthetase family. This famil 96.82
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro- 96.72
PRK03170292 dihydrodipicolinate synthase; Provisional 96.61
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enz 96.58
PRK04147294 N-acetylneuraminate lyase; Provisional 96.48
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 96.36
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A membe 96.3
PRK08091235 ribulose-phosphate 3-epimerase; Validated 96.26
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 96.12
PRK08005210 ribulose-phosphate 3-epimerase; Validated 96.08
TIGR01182205 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox 96.04
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) 96.02
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 95.85
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 95.69
PRK05581220 ribulose-phosphate 3-epimerase; Validated 95.56
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called N-ace 95.54
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases fo 95.29
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chor 95.21
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.17
TIGR00259261 TIGR00259 conserved hypothetical protein TIGR00259; Int 94.3
TIGR01361262 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldo 93.69
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 99.65
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 99.64
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.61
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.61
KOG2335358 consensus 99.39
PRK10605362 N-ethylmaleimide reductase; Provisional 99.07
KOG2333614 consensus 98.98
COG0069485 GltB Glutamate synthase domain 2 [Amino acid transport 98.89
pfam01645367 Glu_synthase Conserved region in glutamate synthase. Th 98.81
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, a 98.66
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 98.51
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.46
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 98.39
TIGR00742326 yjbN TIM-barrel protein, yjbN family; InterPro: IPR0046 98.28
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.23
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 98.18
PRK11750 1483 gltB glutamate synthase subunit alpha; Provisional 98.1
pfam04481243 DUF561 Protein of unknown function (DUF561). Protein of 97.93
KOG2334 477 consensus 97.65
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.53
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 97.23
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 96.48
PRK06857209 consensus 96.34
PRK12330 499 oxaloacetate decarboxylase; Provisional 95.9
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 95.88
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 95.64
TIGR00693210 thiE thiamine-phosphate pyrophosphorylase; InterPro: IP 95.53
pfam02219286 MTHFR Methylenetetrahydrofolate reductase. This family 95.16
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost 94.68
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxy 93.49
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino acid t 92.63
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 91.95
PRK08508279 biotin synthase; Provisional 91.26
TIGR01212307 TIGR01212 radical SAM protein, TIGR01212 family; InterP 90.12
cd02911233 arch_FMN Archeal FMN-binding domain. This family of arc 99.47
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 99.32
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 99.17
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 99.14
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 98.75
TIGR00736234 nifR3_rel_arch TIM-barrel protein, putative; InterPro: 98.71
PRK13117268 consensus 98.57
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 98.54
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 98.49
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 98.48
PRK13127262 consensus 98.47
PRK13139254 consensus 98.46
PRK13135267 consensus 98.41
PRK13116278 consensus 98.4
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 98.39
PRK13123256 consensus 98.36
pfam00290258 Trp_syntA Tryptophan synthase alpha chain. 98.36
PRK00208256 thiG thiazole synthase; Reviewed 98.32
PRK13121265 consensus 98.3
PRK13120285 consensus 98.27
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 98.25
PRK13134257 consensus 98.23
PRK13138264 consensus 98.23
CHL00162267 thiG thiamin biosynthesis protein G; Validated 98.23
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 98.22
PRK13132246 consensus 98.21
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 98.2
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 98.16
PRK13114266 consensus 98.13
PRK13133267 consensus 98.11
PRK13140257 consensus 98.07
PRK13124257 consensus 98.06
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid transp 98.05
PRK13136253 consensus 98.02
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.88
PRK13112279 consensus 97.83
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 97.65
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 97.57
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthesis [N 97.34
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/trypt 97.32
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 97.11
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase; InterPr 97.11
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 97.0
PRK03620296 5-dehydro-4-deoxyglucarate dehydratase; Provisional 96.78
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also call 96.77
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 96.68
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 96.65
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 96.38
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.29
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 95.2
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function pred 94.63
pfam09370268 TIM-br_sig_trns TIM-barrel signal transduction protein. 94.54
KOG4175268 consensus 93.35
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.17
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 99.24
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase [Gen 98.82
PRK13126237 consensus 98.47
PRK00507221 deoxyribose-phosphate aldolase; Provisional 98.31
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the D 98.16
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide transpo 98.1
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino acid t 98.02
cd02812219 PcrB_like PcrB_like proteins. One member of this family 98.02
pfam01791231 DeoC DeoC/LacD family aldolase. This family includes di 97.92
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 97.89
cd00945201 Aldolase_Class_I Class I aldolases. The class I aldolas 97.87
PRK02747 257 consensus 97.77
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 97.74
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 97.73
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 97.7
PRK02145 257 consensus 97.69
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fold [G 97.67
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 97.63
PRK01659 252 consensus 97.59
PRK04281 254 consensus 97.53
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 97.47
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.45
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.41
PRK00830 273 consensus 97.4
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.39
PRK05283258 deoxyribose-phosphate aldolase; Provisional 97.17
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 97.16
PRK07695202 transcriptional regulator TenI; Provisional 97.09
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735 312 hisF imidazoleglycerol phosphate synthase, cyclase subu 97.03
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.01
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 96.92
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 96.9
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 96.71
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 96.7
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 96.55
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 96.34
TIGR01919246 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR 96.19
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 95.98
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 95.45
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 95.38
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 95.16
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 94.8
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme metaboli 94.74
KOG2550 503 consensus 94.71
pfam02581180 TMP-TENI Thiamine monophosphate synthase/TENI. Thiamine 94.65
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 94.56
PRK08649 368 inositol-5-monophosphate dehydrogenase; Validated 94.42
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 94.26
PRK04302223 triosephosphate isomerase; Provisional 92.11
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and h 91.86
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminator (mR 91.85
PRK08999312 hypothetical protein; Provisional 91.74
PRK09282 580 pyruvate carboxylase subunit B; Validated 91.11
TIGR00734230 hisAF_rel hisA/hisF family protein; InterPro: IPR004650 90.72
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding 90.37
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 99.06
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 98.74
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 98.22
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 98.17
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 98.15
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 98.05
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 97.97
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.16
KOG2550503 consensus 97.07
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.68
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.57
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 96.55
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 96.52
PRK08904207 consensus 96.51
PRK08104212 consensus 96.38
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.35
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 95.93
PRK08782219 consensus 95.42
COG0646311 MetH Methionine synthase I (cobalamin-dependent), methy 92.83
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding domain. 98.84
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 98.73
PRK08227291 aldolase; Validated 91.64
PRK07226266 fructose-bisphosphate aldolase; Provisional 90.45
PRK13137266 consensus 98.48
TIGR01768242 GGGP-family geranylgeranylglyceryl phosphate synthase f 97.96
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 97.93
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 97.81
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 97.74
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 97.73
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 97.69
PRK05211 248 consensus 97.62
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.59
PRK13597 252 imidazole glycerol phosphate synthase subunit HisF; Pro 97.55
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.54
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 97.5
pfam01884231 PcrB PcrB family. This family contains proteins that ar 97.36
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 97.11
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.08
PRK06857209 consensus 97.07
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohy 97.07
PRK02615345 thiamine-phosphate pyrophosphorylase; Provisional 97.03
TIGR00674288 dapA dihydrodipicolinate synthase; InterPro: IPR005263 96.92
PRK09427 459 bifunctional indole-3-glycerol phosphate synthase/phosp 96.77
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.75
PRK08104212 consensus 96.69
PRK08904207 consensus 96.64
PRK08782219 consensus 96.63
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine monoph 96.62
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.58
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, 95.98
PRK04180293 pyridoxine biosynthesis protein; Provisional 95.95
KOG0399 2142 consensus 95.83
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohy 95.61
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (P 95.5
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolis 95.23
KOG1606296 consensus 94.93
pfam04309174 G3P_antiterm Glycerol-3-phosphate responsive antitermin 94.55
KOG4201289 consensus 94.22
PRK11572248 copper homeostasis protein CutC; Provisional 93.4
TIGR00343298 TIGR00343 pyridoxine biosynthesis protein; InterPro: IP 92.21
TIGR01303476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 91.3
KOG1799471 consensus 97.74
KOG0564 590 consensus 94.43
TIGR01464351 hemE uroporphyrinogen decarboxylase; InterPro: IPR00636 92.8
PRK02621254 consensus 97.6
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.47
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.46
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 97.38
PRK03220257 consensus 97.35
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.15
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 96.97
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.66
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 96.58
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.18
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 95.84
PRK09517 738 multifunctional thiamine-phosphate pyrophosphorylase/sy 93.23
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 96.97
TIGR00674288 dapA dihydrodipicolinate synthase; InterPro: IPR005263 95.17
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydra 96.89
TIGR01769212 GGGP geranylgeranylglyceryl phosphate synthase; InterPr 96.79
PRK06267324 hypothetical protein; Provisional 95.02
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 93.71
TIGR01361262 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldo 91.2
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>KOG1436 consensus Back     alignment and domain information
>pfam01070 FMN_dh FMN-dependent dehydrogenase Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>KOG0538 consensus Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Members of this entry oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>pfam01180 DHO_dh Dihydroorotate dehydrogenase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>KOG1799 consensus Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652 This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179 This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase) Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>pfam00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>PRK08649 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>PRK13115 consensus Back     alignment and domain information
>PRK02145 consensus Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>PRK01659 consensus Back     alignment and domain information
>PRK00830 consensus Back     alignment and domain information
>PRK04281 consensus Back     alignment and domain information
>PRK02747 consensus Back     alignment and domain information
>PRK05211 consensus Back     alignment and domain information