254780450

254780450

two-component sensor histidine kinase/response regulator hybrid protein

GeneID in NCBI database:8209436Locus tag:CLIBASIA_01675
Protein GI in NCBI database:254780450Protein Accession:YP_003064863.1
Gene range:+(362702, 365113)Protein Length:803aa
Gene description:two-component sensor histidine kinase/response regulator hybrid protein
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:two-component sensor histidine kinase/response regulator hybrid protein; K13587 two-component system, cell cycle sensor histidine kinase and response regulator CckA [EC:2.7.13.3]
SEED prediction:Sensory box histidine kinase/response regulator
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800---
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEHHHHHHHHHcccHHHHccccccEEcccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHcccHHHHHcccccHHHccccccHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEEEcccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEEHHHHHHcccccHHHHccccHHHHccHHHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEEEEEcccccHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccccEEEEcccccccEEEEEEEEccccccHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHcccEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccEEEEccccEEEEEcHHHHHHHccccHHHcccHHHHHccccccHHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEEEEEEccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccEEEEcHHHHHHHcccHHHHHcccccHHHHcccccHHHHHHHcccHHHHcccEEEHHHEEcccccEEEEEEEEEcccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEccHHHHHHHccccHHHHccccHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHccccccccccEEEEEEEcccccccHHHHHHHHccccEEcccccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEEEccccccccccccccccccccHcccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccHccccccccHHHHHHHHHHHHcccc
MLAIVGILLLLLLAIGSiemtikpkipletifmdsepegilitnerghIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLrlksegseEFRLMQSLnnysqnsephwYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIdyldhspvgfmsadhQGKILYINATLAEWIGidlttftsksisigditaGEGLALIQAIrtepshqkittldldlrridnghgipVKIVHHILAscdgkpgesrtvvvsrkncdsgdpsgtiANMRFNRFFNNIPMAIASIDKKGRILRTNAHFlklfpnctegdgtsndiFSIVHKNEKRKIIAALYdandqksdispidsphpqdenrYFRFYISAtldrsteapeeQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDhlllqsrssdasFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLIseppqvkltvDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMlkesgsltvrtrnipsteihtfnysdlptkdmVLVEVedtgigmspdIMEKIFEpffttkkvgegtgLGLSVVYGIIRqsggyilpesevgkgtiFRIFLPryvqehtqeshyshdiaiipqeepadltgnSAIVLLVEDEDSVRRGSkrmletrgytvheafsGTDALKVMEKLQGRVDIvisdvvmpemdgptLLRELRKTYPSLKFIFISGYaedafsknlpkdakfsflskpfslKQLATSVHELLQSDS
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIrtepshqkittlDLDLRRIDNGHGIPVKIVHHIlascdgkpgESRTVVVsrkncdsgdpsgtiANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLfpnctegdgtSNDIFSIVHKNEKRKIIAALYDandqksdispidsphpqdeNRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFsrkqtmrltVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAImlkesgsltvrtrNIPSTeihtfnysdlptkDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLlvededsvrrgskrmletrgytvheafsgtdaLKVMEKLQGRVDivisdvvmpemdGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
MlaivgillllllaigSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIyannaynaltnaVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERK******RELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVS*****************FNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDH***************MEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQ************************GNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSV*ELLQ***
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQ**********************LTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQS**
iHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS
MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target803 two-component sensor histidine kinase/response regulato
254780312122 response regulator receiver protein [Candidatus Li 1e-14
254780413820 PAS/PAC sensor signal transduction histidine kinas 2e-10
254780903766 two-component sensor histidine kinase protein [Can 2e-06
254780476123 two component response regulator [Candidatus Liber 5e-05
254780893 236 two component response regulator [Candidatus Liber 7e-04
255764476792 two-component sensor histidine kinase protein [Can 0.005
254780701495 putative two-component sensor histidine kinase tra 0.007
>gi|254780312|ref|YP_003064725.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Back     alignment
 Score = 73.2 bits (178), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 8/119 (6%)

Query: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDAL-KVMEKLQGRVDIVISDVVMPEMDG 742
           +LL ED+D +RR   + L   GY V    +G  A  KV E+      ++++D+VMPEMDG
Sbjct: 5   ILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREE---PFSLLLTDIVMPEMDG 61

Query: 743 PTLLRELRKTYPSLKFIFISGYAEDAFS--KNLPKDAKFSFLSKPFSLKQLATSVHELL 799
             L R   +  P LK +FI+G+A  A +   N PK+AK   LSKPF L+ L   V+ LL
Sbjct: 62  IELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAK--VLSKPFHLRDLVNEVNRLL 118

>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 35/278 (12%)

Query: 400 EITEQKALEARMAQTQKL-----NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDA 454
           +I+E K  + +++  +K+     +        ++H+    LTAI+  S+ ++   R    
Sbjct: 560 DISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSE-VIKNQRFGPL 618

Query: 455 SFADLMEIKHNANRAAILV----RQLLAFSR----KQTMRLTVLNLTEVIGNLRMMIQKL 506
                +E  +  +R+  LV      LL  S+    K  +    ++L E +     ++Q L
Sbjct: 619 GNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQ-L 677

Query: 507 ISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPST 566
            +   ++ +   +  ++  +  DL   +Q+ +N+  NA H       G + + T      
Sbjct: 678 YANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIH--FTPSGGQIIIST------ 729

Query: 567 EIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFF----TTKKVGEGTGLGLSVV 622
             HT N       + V++ V DTG+GM+   +EK  +PF     + +  GEGTGLGL + 
Sbjct: 730 -THTSN-------EEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLA 781

Query: 623 YGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQES 660
             ++  + G     S   KGT+  I  P Y   H  + 
Sbjct: 782 KAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDC 819

>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Back     alignment
 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 582 VLVEVEDTGIGMSPDIMEKIFEPF-----FTTKKVGEGTGLGLSVVYGIIRQSGGYILPE 636
           V++ + DTGIG+    +EKI +PF        + +G G GLGL++   +    GG +   
Sbjct: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKII 751

Query: 637 SEVGKGTIFRIFLPR 651
           S+ GKGTI  I +P+
Sbjct: 752 SQEGKGTIVTICMPQ 766

>gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Back     alignment
 Score = 41.6 bits (96), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743
           V++VED +   +  + ++ET GY   +  +G +AL++    Q + D++I D+ + E+ G 
Sbjct: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR--QHKPDVIIMDIQLQEISGL 62

Query: 744 TLLRELRK--TYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSL 788
            + +++++      +  I ++ +A     + + K    +++SKP SL
Sbjct: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109

>gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Back     alignment
 Score = 37.7 bits (86), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 62/119 (52%), Gaps = 6/119 (5%)

Query: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743
           +LL+ED+ ++    + ML++  + V+    G D +++ +  +   D +I D+ + ++ G 
Sbjct: 3   ILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYE--FDAIILDLGLTDIPGF 60

Query: 744 TLLRELRKTYPSLKFIFISGYA--EDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQ 800
            +LR LR    S     +SG +  ED   + L   A   ++SKPF+ ++L   +  +++
Sbjct: 61  EVLRALRVAKISTPVCILSGMSSIEDKV-RGLQSGAD-DYISKPFNKEELVARIRAIVR 117

>gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Back     alignment
 Score = 35.0 bits (79), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 583 LVEVEDTGIGMSPDIMEKIFEPFFTTKKVGE--GTGLGLSVVYGIIRQSGGYI-LPESEV 639
           +  V++ G  +  D+ + +F  F +    G+  G GLGLS+V   I   GG++ +  S+ 
Sbjct: 720 IFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDE 779

Query: 640 GKGTI 644
           G  TI
Sbjct: 780 GVTTI 784

>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Back     alignment
 Score = 34.3 bits (77), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 117/275 (42%), Gaps = 40/275 (14%)

Query: 402 TEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRS--SDASFADL 459
           T ++A E  +A+++ L         ++H+    L AIL  S+ + L++    ++ ++ + 
Sbjct: 238 TRKRAEEENLAKSRFL-------ASMSHELRTPLNAILGFSEVIELETMGPLNNETYKEY 290

Query: 460 MEIKHNANRAAI-LVRQLLAFSRKQTMRL----TVLNLTEVIGNLRMMIQKLISEPPQVK 514
           +   H + +  + L+ ++L  SR +  R     + ++L +++    +M+Q L ++   ++
Sbjct: 291 IGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQ-LRAQEKNIE 349

Query: 515 LTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYS 574
           +    +  L  V  D     QV++NL  NA             V+   I      T  ++
Sbjct: 350 IFQKIDPSLSSVWADEKGMRQVILNLLSNA-------------VKFTAIGGRVHVTVGWT 396

Query: 575 DLPTKDMVLVEVEDTGIGMS----PDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSG 630
               +    + ++D G G++    P ++    +     K   +G GLGL +   I+   G
Sbjct: 397 SGRGQ---YISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHG 453

Query: 631 GYILPESEVGKGTIFRIFLP-----RYVQEHTQES 660
           G  L  S++ +G      LP      ++ E   ES
Sbjct: 454 GQFLIRSKLREGVEVIAILPNTRVLNFIPEDNHES 488

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target803 two-component sensor histidine kinase/response regulato
315122102794 two-component sensor histidine kinase/response regulato 1 0.0
86357941867 two-component sensor histidine kinase/response regulato 1 0.0
190892012867 two-component sensor histidine kinase/response regulato 1 0.0
222086167871 two-component sensor histidine kinase/response regulato 1 0.0
327191887867 putative two-component sensor histidine kinase/response 1 0.0
209549555867 multi-sensor hybrid histidine kinase [Rhizobium legumin 1 0.0
116252386867 two-component sensor histidine kinase transcriptional r 1 0.0
241204893867 PAS/PAC sensor hybrid histidine kinase [Rhizobium legum 1 0.0
15965555869 putative sensor histidine kinase transmembrane protein 1 0.0
307318523869 multi-sensor hybrid histidine kinase [Sinorhizobium mel 1 0.0
>gi|315122102|ref|YP_004062591.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 794 Back     alignment and organism information
 Score = 1463 bits (3787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/794 (88%), Positives = 744/794 (93%)

Query: 10  LLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNALTNAVWNKRTK 69
           ++ LAI S+EM +KP IPLE +FMD++PEGILITNERGHI+YANNAYN+LTN  WNKR K
Sbjct: 1   MVFLAINSLEMIMKPSIPLEKVFMDTDPEGILITNERGHIMYANNAYNSLTNVDWNKRIK 60

Query: 70  SLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHWYRLKARVLPI 129
           SLESLLSRNQEA EALYRL N+LR+K EG EEFRLM SL N+SQN  PHWYRLKAR+LP+
Sbjct: 61  SLESLLSRNQEAGEALYRLTNNLRVKKEGKEEFRLMHSLKNHSQNLGPHWYRLKARILPV 120

Query: 130 SLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATL 189
           SLHKEK LYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATL
Sbjct: 121 SLHKEKALYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQGKILYINATL 180

Query: 190 AEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLRRIDNGHGIPV 249
           AEWIGIDLTTFTS+SISIGDITAGEGL+LIQA++ EP +QK  TLDLD RRIDNGHG+PV
Sbjct: 181 AEWIGIDLTTFTSRSISIGDITAGEGLSLIQAVQAEPDNQKTVTLDLDFRRIDNGHGLPV 240

Query: 250 KIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPMAIASIDKKGR 309
           K+VHH+LASCDGKPGESRTVVVSRKNCD  DPSGTIANMRFNRFFNNIPMAIASID+KGR
Sbjct: 241 KLVHHVLASCDGKPGESRTVVVSRKNCDFNDPSGTIANMRFNRFFNNIPMAIASIDRKGR 300

Query: 310 ILRTNAHFLKLFPNCTEGDGTSNDIFSIVHKNEKRKIIAALYDANDQKSDISPIDSPHPQ 369
           ILRTNA FLKLFPN  + DGTSNDIFSIVHKNEK KI+AAL DAN+QKSDI  IDSPHP+
Sbjct: 301 ILRTNAPFLKLFPNAIKSDGTSNDIFSIVHKNEKSKIVAALNDANNQKSDIPAIDSPHPK 360

Query: 370 DENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAH 429
           DENR+FRFYI+ATLDRSTEAPEE AILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAH
Sbjct: 361 DENRHFRFYINATLDRSTEAPEEHAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIAH 420

Query: 430 DFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMRLTV 489
           DFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTM L V
Sbjct: 421 DFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTMCLVV 480

Query: 490 LNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIM 549
           LNLTEVI NLRMMIQKLISEPPQVKL VDYERDLW VKTDLSQFEQVLVNLCVNAHHAIM
Sbjct: 481 LNLTEVISNLRMMIQKLISEPPQVKLHVDYERDLWDVKTDLSQFEQVLVNLCVNAHHAIM 540

Query: 550 LKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTK 609
           LKESGSLT+RTRNIPSTEIH+FNYSDLP KDMVLVEVEDTGIG+S DIMEKIFEPFFTTK
Sbjct: 541 LKESGSLTIRTRNIPSTEIHSFNYSDLPKKDMVLVEVEDTGIGISSDIMEKIFEPFFTTK 600

Query: 610 KVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAII 669
           +VG+GTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPR+VQE  Q S +SHDI I 
Sbjct: 601 EVGKGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRHVQEDVQLSTHSHDITIK 660

Query: 670 PQEEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVD 729
           P EE ADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEA SGTDALKVME+LQG+VD
Sbjct: 661 PPEESADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYTVHEACSGTDALKVMEELQGKVD 720

Query: 730 IVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLK 789
           IV+SDVVMPEMDGPTLLRELRKTYP+LKFIFISGYAEDAFSKNL KDAKFSFLSKPFSLK
Sbjct: 721 IVVSDVVMPEMDGPTLLRELRKTYPNLKFIFISGYAEDAFSKNLVKDAKFSFLSKPFSLK 780

Query: 790 QLATSVHELLQSDS 803
           QLATSVHELLQSDS
Sbjct: 781 QLATSVHELLQSDS 794


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357941|ref|YP_469833.1| two-component sensor histidine kinase/response regulator hybrid protein [Rhizobium etli CFN 42] Length = 867 Back     alignment and organism information
>gi|190892012|ref|YP_001978554.1| two-component sensor histidine kinase/response regulator hybrid protein [Rhizobium etli CIAT 652] Length = 867 Back     alignment and organism information
>gi|222086167|ref|YP_002544699.1| two-component sensor histidine kinase/response regulator hybrid protein [Agrobacterium radiobacter K84] Length = 871 Back     alignment and organism information
>gi|327191887|gb|EGE58878.1| putative two-component sensor histidine kinase/response regulator hybrid protein [Rhizobium etli CNPAF512] Length = 867 Back     alignment and organism information
>gi|209549555|ref|YP_002281472.1| multi-sensor hybrid histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 867 Back     alignment and organism information
>gi|116252386|ref|YP_768224.1| two-component sensor histidine kinase transcriptional regulatory protein [Rhizobium leguminosarum bv. viciae 3841] Length = 867 Back     alignment and organism information
>gi|241204893|ref|YP_002975989.1| PAS/PAC sensor hybrid histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 867 Back     alignment and organism information
>gi|15965555|ref|NP_385908.1| putative sensor histidine kinase transmembrane protein [Sinorhizobium meliloti 1021] Length = 869 Back     alignment and organism information
>gi|307318523|ref|ZP_07597957.1| multi-sensor hybrid histidine kinase [Sinorhizobium meliloti AK83] Length = 869 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target803 two-component sensor histidine kinase/response regulato
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 9e-76
PRK13837828 PRK13837, PRK13837, two-component VirA-like sensor kina 1e-57
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 5e-17
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; Prov 5e-41
COG0642336 COG0642, BaeS, Signal transduction histidine kinase [Si 3e-31
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provisional 2e-30
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system histi 1e-18
COG5000712 COG5000, NtrY, Signal transduction histidine kinase inv 1e-15
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II); Pro 7e-15
COG4192673 COG4192, COG4192, Signal transduction histidine kinase 1e-13
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provisional 1e-12
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regulated 5e-12
COG5002459 COG5002, VicK, Signal transduction histidine kinase [Si 2e-11
COG4191603 COG4191, COG4191, Signal transduction histidine kinase 3e-34
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 1e-25
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 4e-19
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 2e-14
COG3852363 COG3852, NtrB, Signal transduction histidine kinase, ni 1e-23
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor kinase 6e-13
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative regu 8e-12
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine kinas 9e-22
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 3e-21
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 6e-21
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 1e-19
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 5e-15
PRK11086542 PRK11086, PRK11086, sensory histidine kinase DcuS; Prov 6e-12
PRK10841 924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 2e-07
PRK15053545 PRK15053, dpiB, sensor histidine kinase DpiB; Provision 2e-07
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 2e-07
cd00156113 cd00156, REC, Signal receiver domain; originally though 2e-20
COG2204 464 COG2204, AtoC, Response regulator containing CheY-like 5e-20
pfam00072111 pfam00072, Response_reg, Response regulator receiver do 1e-19
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal transduc 3e-16
COG4753 475 COG4753, COG4753, Response regulator containing CheY-li 4e-16
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regulatory 4e-13
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 1e-12
COG0745 229 COG0745, OmpR, Response regulators consisting of a CheY 2e-12
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 2e-12
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 2e-12
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provisiona 3e-12
COG3437 360 COG3437, COG3437, Response regulator containing a CheY- 6e-12
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 2e-10
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory protein 6e-08
COG3947 361 COG3947, COG3947, Response regulator containing CheY-li 1e-07
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 1e-07
COG3279 244 COG3279, LytT, Response regulator of the LytR/AlgR fami 2e-07
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provisional 3e-07
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 6e-07
PRK09483217 PRK09483, PRK09483, response regulator; Provisional 6e-07
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response regulat 1e-06
PRK10766221 PRK10766, PRK10766, DNA-binding transcriptional regulat 2e-06
PRK10529 225 PRK10529, PRK10529, DNA-binding transcriptional activat 4e-06
COG4567182 COG4567, COG4567, Response regulator consisting of a Ch 6e-06
COG4565 224 COG4565, CitB, Response regulator of citrate/malate met 8e-06
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory protein 3e-05
PRK10955 232 PRK10955, PRK10955, DNA-binding transcriptional regulat 3e-05
PRK15479 221 PRK15479, PRK15479, transcriptional regulatory protein 5e-05
PRK09958204 PRK09958, PRK09958, DNA-binding transcriptional activat 8e-05
PRK10336219 PRK10336, PRK10336, DNA-binding transcriptional regulat 2e-04
TIGR02875 262 TIGR02875, spore_0_A, sporulation transcription factor 3e-04
PRK10643222 PRK10643, PRK10643, DNA-binding transcriptional regulat 3e-04
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional regu 0.001
KOG0519786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 3e-10
COG3290537 COG3290, CitA, Signal transduction histidine kinase reg 3e-10
COG0643716 COG0643, CheA, Chemotaxis protein histidine kinase and 2e-08
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kinase 1e-05
PRK09470461 PRK09470, cpxA, two-component sensor protein; Provision 2e-05
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisional 2e-05
PRK10547670 PRK10547, PRK10547, chemotaxis protein CheA; Provisiona 3e-04
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kinase; V 4e-10
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisional 2e-04
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provisional 1e-09
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; Prov 2e-04
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; Provi 4e-04
smart0044855 smart00448, REC, cheY-homologous receiver domain 6e-08
PRK11083 228 PRK11083, PRK11083, DNA-binding response regulator CreB 2e-06
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 2e-06
PRK11173 237 PRK11173, PRK11173, two-component response regulator; P 5e-06
COG2201 350 COG2201, CheB, Chemotaxis response regulator containing 1e-05
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein CheY; 4e-05
PRK10693 303 PRK10693, PRK10693, response regulator of RpoS; Provisi 7e-05
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL; Pro 2e-04
PRK15369211 PRK15369, PRK15369, two component system sensor kinase 0.001
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 1e-07
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/phosph 4e-05
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|184354 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|30987 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|163071 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|34605 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|33927 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182496 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|33642 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163090 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|182952 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|185013 PRK15053, dpiB, sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|181897 PRK09483, PRK09483, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|182168 PRK09958, PRK09958, DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30988 COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162333 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|181882 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182537 PRK10547, PRK10547, chemotaxis protein CheA; Provisional Back     alignment and domain information
>gnl|CDD|181772 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|128724 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information
>gnl|CDD|185267 PRK15369, PRK15369, two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 803 two-component sensor histidine kinase/response regulato
PRK13557538 histidine kinase; Provisional 100.0
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK10841947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
PRK13837831 two-component VirA-like sensor kinase; Provisional 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
KOG0519786 consensus 100.0
PRK13560807 hypothetical protein; Provisional 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 100.0
COG5000712 NtrY Signal transduction histidine kinase involved in n 100.0
COG3290537 CitA Signal transduction histidine kinase regulating ci 100.0
PRK13559363 hypothetical protein; Provisional 99.93
PRK10364455 sensor protein ZraS; Provisional 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transductio 100.0
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 100.0
COG4192673 Signal transduction histidine kinase regulating phospho 99.97
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.65
PRK11644497 sensory histidine kinase UhpB; Provisional 99.62
COG3920221 Signal transduction histidine kinase [Signal transducti 99.58
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 99.27
KOG0519786 consensus 96.84
COG5385214 Uncharacterized protein conserved in bacteria [Function 96.76
PRK097761116 putative sensor protein; Provisional 100.0
PRK13560807 hypothetical protein; Provisional 100.0
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 99.39
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 100.0
PRK09776 1116 putative sensor protein; Provisional 100.0
PRK11359 799 cAMP phosphodiesterase; Provisional 99.96
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.86
KOG3559598 consensus 97.5
KOG3560712 consensus 96.61
PRK11359799 cAMP phosphodiesterase; Provisional 100.0
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.79
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.96
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.59
KOG3558768 consensus 98.15
KOG3560712 consensus 96.37
KOG3559598 consensus 95.37
PRK10618881 phosphotransfer intermediate protein in two-component r 99.94
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory prote 99.94
PRK10693 337 response regulator of RpoS; Provisional 99.93
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.93
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.92
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.92
pfam00072111 Response_reg Response regulator receiver domain. This d 99.92
PRK09581 457 pleD response regulator PleD; Reviewed 99.92
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.92
cd00156113 REC Signal receiver domain; originally thought to be un 99.92
PRK11083 229 DNA-binding response regulator CreB; Provisional 99.9
PRK09468 239 ompR osmolarity response regulator; Provisional 99.9
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.9
PRK09836 226 DNA-binding transcriptional activator CusR; Provisional 99.9
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.9
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.89
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.89
PRK10161 229 transcriptional regulator PhoB; Provisional 99.89
PRK09390202 fixJ response regulator FixJ; Provisional 99.89
CHL00148 240 orf27 Ycf27; Reviewed 99.89
PRK11517 223 transcriptional regulatory protein YedW; Provisional 99.89
PRK10430 239 DNA-binding transcriptional activator DcuR; Provisional 99.88
PRK10643 222 DNA-binding transcriptional regulator BasR; Provisional 99.88
PRK13435141 response regulator; Provisional 99.88
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provisional 99.88
PRK11173 237 two-component response regulator; Provisional 99.87
COG4753 475 Response regulator containing CheY-like receiver domain 99.87
PRK10529 225 DNA-binding transcriptional activator KdpE; Provisional 99.87
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provisional 99.87
PRK10701 240 DNA-binding transcriptional regulator RstA; Provisional 99.87
PRK10766 224 DNA-binding transcriptional regulator TorR; Provisional 99.87
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provisional 99.87
COG0745 229 OmpR Response regulators consisting of a CheY-like rece 99.86
PRK13856 241 two-component response regulator VirG; Provisional 99.84
TIGR01387 219 cztR_silR_copR heavy metal response regulator; InterPro 99.84
PRK00742 345 chemotaxis-specific methylesterase; Provisional 99.83
PRK12555 340 chemotaxis-specific methylesterase; Provisional 99.81
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.81
COG3437 360 Response regulator containing a CheY-like receiver doma 99.81
PRK09191261 two-component response regulator; Provisional 99.81
PRK09483216 response regulator; Provisional 99.8
PRK10403215 transcriptional regulator NarP; Provisional 99.79
PRK10651216 transcriptional regulator NarL; Provisional 99.79
PRK09935210 transcriptional regulator FimZ; Provisional 99.78
TIGR02875 270 spore_0_A sporulation transcription factor Spo0A; Inter 99.78
COG2197211 CitB Response regulator containing a CheY-like receiver 99.77
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.77
PRK10840216 transcriptional regulator RcsB; Provisional 99.74
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.73
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.71
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.71
COG3947 361 Response regulator containing CheY-like receiver and SA 99.68
COG4565 224 CitB Response regulator of citrate/malate metabolism [T 99.68
PRK11697 239 putative two-component response-regulatory protein YehT 99.64
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.57
COG4567182 Response regulator consisting of a CheY-like receiver d 99.55
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.54
COG2201 350 CheB Chemotaxis response regulator containing a CheY-li 99.47
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.42
COG3707194 AmiR Response regulator with putative antiterminator ou 99.26
COG3279 244 LytT Response regulator of the LytR/AlgR family [Transc 99.11
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 98.87
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.58
COG4999140 Uncharacterized domain of BarA-like signal transduction 94.06
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.92
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.91
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.88
PRK03660146 anti-sigma F factor; Provisional 99.52
PRK04069158 serine-protein kinase RsbW; Provisional 98.43
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 98.33
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 98.07
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 96.0
PRK10547662 chemotaxis protein CheA; Provisional 99.8
COG0643716 CheA Chemotaxis protein histidine kinase and related ki 99.78
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 99.07
KOG0787414 consensus 98.74
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.76
COG4585365 Signal transduction histidine kinase [Signal transducti 99.54
COG2972456 Predicted signal transduction protein with a C-terminal 99.39
COG4564459 Signal transduction histidine kinase [Signal transducti 99.33
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.29
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 93.76
PRK13557538 histidine kinase; Provisional 99.73
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.62
PRK13558674 bacterio-opsin activator; Provisional 99.36
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.32
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.31
PRK11360607 sensory histidine kinase AtoS; Provisional 99.18
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 99.13
PRK11006431 phoR phosphate regulon sensor protein; Provisional 99.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 98.48
PRK11086541 sensory histidine kinase DcuS; Provisional 98.24
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.15
COG5000712 NtrY Signal transduction histidine kinase involved in n 97.76
COG3290537 CitA Signal transduction histidine kinase regulating ci 97.7
PRK10841947 hybrid sensory kinase in two-component regulatory syste 97.66
KOG1229775 consensus 95.72
pfam08670148 MEKHLA MEKHLA domain. The MEKHLA domain shares similari 95.4
PRK10060663 RNase II stability modulator; Provisional 99.64
PRK10060663 RNase II stability modulator; Provisional 99.53
PRK13559363 hypothetical protein; Provisional 99.45
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.39
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 99.16
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 98.9
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 98.69
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.4
KOG0501 971 consensus 97.24
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 97.03
pfam08670148 MEKHLA MEKHLA domain. The MEKHLA domain shares similari 96.44
PRK13558674 bacterio-opsin activator; Provisional 99.35
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 98.25
COG2461409 Uncharacterized conserved protein [Function unknown] 96.21
KOG1229 775 consensus 94.87
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.3
PRK099591197 hybrid sensory histidine kinase in two-component regula 98.58
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.13
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 97.98
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. This family describes a form of threonine dehydratase, with two copies of the threonine dehydratase C-terminal domain IPR001721 from INTERPRO. Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine.; GO: 0004794 L-threonine ammonia-lyase activity, 0009097 isoleucine biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01124">TIGR01124508 ilvA_2Cterm threonine ammonia-lyase, biosynthetic; Inte 96.11
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.23
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 99.12
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 98.92
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 98.92
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.99
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 98.85
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 96.92
PRK09224504 threonine dehydratase; Reviewed 94.06
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 98.65
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.48
KOG0501 971 consensus 95.43
KOG3753 1114 consensus 93.69
KOG3558768 consensus 98.5
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.5
COG3706435 PleD Response regulator containing a CheY-like receiver 98.48
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 95.73
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.42
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 97.69
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 97.28
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.41
PRK04184533 DNA topoisomerase VI subunit B; Validated 98.35
PRK00095612 mutL DNA mismatch repair protein; Reviewed 98.32
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 98.05
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.85
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 92.38
KOG3561803 consensus 92.25
TIGR00585367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 98.17
KOG3753 1114 consensus 97.32
PRK05218612 heat shock protein 90; Provisional 96.96
KOG1978672 consensus 94.77
PRK13566724 anthranilate synthase; Provisional 96.67
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 96.37
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 96.46
KOG1979694 consensus 95.54
PTZ00130824 heat shock protein 90; Provisional 95.47
COG2461409 Uncharacterized conserved protein [Function unknown] 94.06
KOG0019656 consensus 90.4
COG0313275 Predicted methyltransferases [General function predicti 94.83
PRK12483521 threonine dehydratase; Reviewed 92.79
PRK08526403 threonine dehydratase; Provisional 92.32
KOG3561803 consensus 94.75
smart0008643 PAC Motif C-terminal to PAS motifs (likely to contribut 94.56
KOG1977 1142 consensus 93.96
smart0008643 PAC Motif C-terminal to PAS motifs (likely to contribut 93.93
TIGR01058655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 90.51
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 91.71
cd01844177 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hy 90.85
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG3559 consensus Back     alignment and domain information
>KOG3560 consensus Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>KOG3560 consensus Back     alignment and domain information
>KOG3559 consensus Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information