254780451

254780451

aconitate hydratase

GeneID in NCBI database:8209437Locus tag:CLIBASIA_01680
Protein GI in NCBI database:254780451Protein Accession:YP_003064864.1
Gene range:-(365407, 368097)Protein Length:896aa
Gene description:aconitate hydratase
COG prediction:[C] Aconitase A
KEGG prediction:acnA; aconitate hydratase (EC:4.2.1.3); K01681 aconitate hydratase 1 [EC:4.2.1.3]
SEED prediction:Aconitate hydratase (EC 4.2.1.3)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Glyoxylate and dicarboxylate metabolism [PATH:las00630]
Subsystem involved in SEED:Biogenesis of c-type cytochromes;
TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890------
MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
ccccccccccccEEEEccEEEEEEcHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccEEEEEEEEEEEccccHHHHHHHHHccHHHHHcccccccccccccEEEEccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEEEHHHcccccccccccccccccccEEEEcccccccccccEEEEEcccHHHHHHHHccccEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEHHHccEEEccccccccccccHHHcccHHHHcccHHHHHHHHHHHccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHcccHHHHHHcccEEEcccHHHccccccccccHHHHHHccccccEEEEEcccccccccccccccEEEEccHHHHHHHHHHEEccccccccccccccccccEEEEccccccHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccHHHHHccccHHHHcccccccccHHHHHHHHHcccHHHHHHHcccccccccEEEccccccccccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccEEEEEcccHHHHHHHccccccEEEEccccccccccEEEEEEEcccccEEEEEEEEEEccHHHHHHHHcccHHHHHHHHHc
cccccccHHHccccccccccEEEEcHHHHHHcccccccccccHHHHHHHHHHHcccccEccHHHHHHHHHHHccccccccEEEccccEEEEcccccccHHHHHHHHHHHHHHHcccHHHcccccccEEEEEcEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEccccccEEEEEcHHHHHHHHEEccccccEEEcccccEEccccHHHHHHHccEEEEccHHHHHHHHHcccEEEEccEEEEEEEEccccccccHHHHHHHHHHHHcccccEcEEEEEEcHHHHHccHHHHHHHHHHHHHHcEcEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHccccHHccccEEEEEcccEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccHHHHHHccccEEEEcccccccccccccHHHHHHHHcccEEEEEEEcccccccccccccccHHHcccccEEEEEHHcccccccccccccccccccccEEEEcccccHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHcEccccccEEcccccEEEccccccccccccccccccccccEEEEEccccccccccccccccccccHHHHHHHHccccccccccccccccccEEHEHccHHHHEEHHHHcccccccccEEEEccccccEEHHHHHHHHHHccccEEEEccccEcEcccccHHHHHHHHccEEEEEEccEcHHHHHHHHHcccEEEEEccHHHHHHccccccEEEEEEcccccccccEEEEEEEcccccEEEEEEEEEEccHHHHHHHccccHHHHHHHHcc
msrslnsfncrsilsvggidyvyyslpkaeanglqgisrlpCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMqdftgvpaVVDLAAMRDAIVVlggdpqninplvpvdlvidhslivdysgnkdavtrnkdleyQRNEERYRFLKWGQksfknfrvvppgtgichqinleylgqsvwtknengeniaypdtcvgtdshTTMINALGILGWGVGGIEAEAAMlgcpismllpevvgfevtgslqegvtaTDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIanmapeygatcgffpvdrgtidYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMkldlgnvspsvagprrpesrlslsevpsSFVTEMNEYYkkshtldekypvkgcdfhlkhgDVAIASITsctntfnpsvmIGAGLLARNAVRaglkskpwvktscapgsqvSYEYLVQAGLVEYLEALGFSLvgfgcttcignsgaLKKEISEVIHQKSLVVAGVLsgnrnfegrispdveanyllspPLVVAYALAGNVRknlikdpigedqqgspvylrdiwpkdseiQSFVNKYVTCDLykkkysdvfkgdsswwnievpesetymwdekstyvrnppyfetiskHIPEIVDICGARILCLlgdkittdhispagsiplQSAAASYLRQrgvkekdfnqfgtrrgnhevmmrgtfsnIRICNYMlgeegkkggytihypskeeLFIYDAAMRYKVDQVPLVVFAGVeygngssrdwaakgtrlLGVRSVIAESFERIHRsnligmgvipfafgkgiswknlnikgdeiinirklktisprqestleihysdgtfkcvpiICCIDTLdeinhlknGGILQAVLRQLS
msrslnsfncrsilsvGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVdysgnkdavtrnkdleyqrnEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRlsgrsnsrvdLVEAYTkvqgmwredIDYEKVAFTKkmkldlgnvspsvagprrpesrlslsevpssfVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLikdpigedqqgspVYLRDIWPKDSEIQSFVNKYVTCDLYKKKysdvfkgdsswwnIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRgvkekdfnqfgtrrgnhevmmrgtfSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYgngssrdwaakgtrLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINirklktisprqESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
***********SILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTE*****************KGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQL*
********NCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVS***************SEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
******SFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS
MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target896 aconitate hydratase [Candidatus Liberibacter asiaticus
315122101897 aconitate hydratase [Candidatus Liberibacter solanacear 1 0.0
86359524896 aconitate hydratase [Rhizobium etli CFN 42] Length = 89 1 0.0
190893792896 aconitate hydratase [Rhizobium etli CIAT 652] Length = 1 0.0
227823751896 aconitate hydratase [Sinorhizobium fredii NGR234] Lengt 1 0.0
209551309896 aconitate hydratase [Rhizobium leguminosarum bv. trifol 1 0.0
222087510906 aconitate hydratase 1 [Agrobacterium radiobacter K84] L 1 0.0
241206745896 aconitate hydratase [Rhizobium leguminosarum bv. trifol 1 0.0
116254263896 aconitate hydratase [Rhizobium leguminosarum bv. viciae 1 0.0
15966982896 aconitate hydratase [Sinorhizobium meliloti 1021] Lengt 1 0.0
150398277896 aconitate hydratase [Sinorhizobium medicae WSM419] Leng 1 0.0
>gi|315122101|ref|YP_004062590.1| aconitate hydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 897 Back     alignment and organism information
 Score = 1541 bits (3989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/896 (82%), Positives = 824/896 (91%)

Query: 1   MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTV 60
           MS+SL+SFNCRS+LSVGGIDYVYYSLPKAEANGLQGISRLPCS+KVLLENLLRFEDG TV
Sbjct: 1   MSQSLDSFNCRSVLSVGGIDYVYYSLPKAEANGLQGISRLPCSIKVLLENLLRFEDGRTV 60

Query: 61  TKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNI 120
           T+E I+AFVKWLDNKGTVESEV+YR SRVLMQDFTGVPAVVDLAAMRDAI VLGGDPQ+I
Sbjct: 61  TQEHIYAFVKWLDNKGTVESEVAYRPSRVLMQDFTGVPAVVDLAAMRDAICVLGGDPQDI 120

Query: 121 NPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGT 180
           NPLVPVDLVIDHSLIVD+ G K ++ RNK+LEYQRNEERY FLKWGQK+F NFRVVPPGT
Sbjct: 121 NPLVPVDLVIDHSLIVDHFGKKSSIMRNKELEYQRNEERYCFLKWGQKAFNNFRVVPPGT 180

Query: 181 GICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAM 240
           GICHQINLEYL QSVWT+N++GENIAYPDTCVGTDSHTTMINALG+LGWGVGGIEAEAAM
Sbjct: 181 GICHQINLEYLAQSVWTQNKDGENIAYPDTCVGTDSHTTMINALGVLGWGVGGIEAEAAM 240

Query: 241 LGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVL 300
           LG PISML+PE+VGFEV+G L+EGVTATDLVLTI Q+LRKEGVVSKFVEFFGSGFE+M L
Sbjct: 241 LGQPISMLIPEIVGFEVSGELKEGVTATDLVLTIVQILRKEGVVSKFVEFFGSGFENMAL 300

Query: 301 ADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYE 360
           ADRATIANMAPEYGATCGFFPVD+ T DYLRLS R  +RV LVEAY K QGMWREDIDYE
Sbjct: 301 ADRATIANMAPEYGATCGFFPVDKITTDYLRLSNRLENRVALVEAYNKAQGMWREDIDYE 360

Query: 361 KVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKG 420
           K+ FTKK+KL LG++ PSV+GPRRPESR+ L EVPS+F+  M++YYKK  TL+EKYPV+G
Sbjct: 361 KIVFTKKIKLSLGDIVPSVSGPRRPESRIPLGEVPSNFLVAMDQYYKKYDTLEEKYPVEG 420

Query: 421 CDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSY 480
            DF+LKHGDV IA+ITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQV+Y
Sbjct: 421 YDFYLKHGDVVIAAITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVAY 480

Query: 481 EYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFE 540
           EYLVQAGLVEYL ALGF+LVGFGCTTCIGNSG L +EIS VI++K LVV GVLSGNRNFE
Sbjct: 481 EYLVQAGLVEYLNALGFNLVGFGCTTCIGNSGPLNQEISAVINEKKLVVVGVLSGNRNFE 540

Query: 541 GRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSF 600
           GRISPDVEANYLLSPPLVVAYALAG +RKN+ KDPIGE+QQG+PVYL+DIWP DSEIQS+
Sbjct: 541 GRISPDVEANYLLSPPLVVAYALAGTIRKNITKDPIGENQQGNPVYLKDIWPTDSEIQSY 600

Query: 601 VNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEI 660
           +N+YVT DLYKKKYS+VFKGDSSWWNI VPESETY+W E STYVRNPPYFE I+    ++
Sbjct: 601 INQYVTRDLYKKKYSNVFKGDSSWWNINVPESETYIWGENSTYVRNPPYFEMIADTNRDV 660

Query: 661 VDICGARILCLLGDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVM 720
            DICGARILCLLG KITTDHISPAGSIPL+S+A  YL Q+G++E DFNQFGTRRGNHEVM
Sbjct: 661 SDICGARILCLLGSKITTDHISPAGSIPLESSAGHYLLQQGIEENDFNQFGTRRGNHEVM 720

Query: 721 MRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGN 780
           +RGTFSNIRI N+MLG++G+KGGYTIHYPSKEE+FIYDAAMRYK D++PLVVFAG EYGN
Sbjct: 721 VRGTFSNIRIFNHMLGKKGRKGGYTIHYPSKEEVFIYDAAMRYKADKIPLVVFAGSEYGN 780

Query: 781 GSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIIN 840
           GSSRDWAAKGT+LLGVR+VIAESFERIHRSNLIGMG+IPF+F K +SW+ LNIKGDEII+
Sbjct: 781 GSSRDWAAKGTKLLGVRAVIAESFERIHRSNLIGMGIIPFSFEKDMSWEKLNIKGDEIID 840

Query: 841 IRKLKTISPRQESTLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS 896
           I+ LK ISPRQ+S LEI YSDG  K VPIICC+DTLDEIN+LKNGGILQ VLRQ++
Sbjct: 841 IKGLKMISPRQQSILEISYSDGMSKRVPIICCVDTLDEINYLKNGGILQTVLRQIA 896


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359524|ref|YP_471416.1| aconitate hydratase [Rhizobium etli CFN 42] Length = 896 Back     alignment and organism information
>gi|190893792|ref|YP_001980334.1| aconitate hydratase [Rhizobium etli CIAT 652] Length = 896 Back     alignment and organism information
>gi|227823751|ref|YP_002827724.1| aconitate hydratase [Sinorhizobium fredii NGR234] Length = 896 Back     alignment and organism information
>gi|209551309|ref|YP_002283226.1| aconitate hydratase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 896 Back     alignment and organism information
>gi|222087510|ref|YP_002546047.1| aconitate hydratase 1 [Agrobacterium radiobacter K84] Length = 906 Back     alignment and organism information
>gi|241206745|ref|YP_002977841.1| aconitate hydratase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 896 Back     alignment and organism information
>gi|116254263|ref|YP_770101.1| aconitate hydratase [Rhizobium leguminosarum bv. viciae 3841] Length = 896 Back     alignment and organism information
>gi|15966982|ref|NP_387335.1| aconitate hydratase [Sinorhizobium meliloti 1021] Length = 896 Back     alignment and organism information
>gi|150398277|ref|YP_001328744.1| aconitate hydratase [Sinorhizobium medicae WSM419] Length = 896 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target896 aconitate hydratase [Candidatus Liberibacter asiaticus
KOG0452892 KOG0452, KOG0452, KOG0452, RNA-binding translational re 0.0
PRK09277888 PRK09277, PRK09277, aconitate hydratase; Validated 0.0
PRK12881889 PRK12881, acnA, aconitate hydratase; Provisional 0.0
TIGR01341876 TIGR01341, aconitase_1, aconitate hydratase 1 0.0
PTZ00092898 PTZ00092, PTZ00092, aconitate hydratase-like protein; P 0.0
PLN00070936 PLN00070, PLN00070, aconitate hydratase 0.0
TIGR02333858 TIGR02333, 2met_isocit_dHY, 2-methylisocitrate dehydrat 0.0
COG1048861 COG1048, AcnA, Aconitase A [Energy production and conve 0.0
cd01586404 cd01586, AcnA_IRP, Aconitase A catalytic domain 0.0
pfam00330464 pfam00330, Aconitase, Aconitase family (aconitate hydra 1e-135
cd01351389 cd01351, Aconitase, Aconitase catalytic domain; Aconita 9e-75
cd01585380 cd01585, AcnA_Bact, Aconitase catalyzes the reversible 6e-43
cd01584412 cd01584, AcnA_Mitochondrial, Aconitase catalyzes the re 2e-42
PRK00402418 PRK00402, PRK00402, 3-isopropylmalate dehydratase large 9e-38
cd01580171 cd01580, AcnA_IRP_Swivel, Aconitase A swivel domain 1e-73
pfam00694131 pfam00694, Aconitase_C, Aconitase C-terminal domain 5e-39
cd01579121 cd01579, AcnA_Bact_Swivel, Bacterial Aconitase-like swi 1e-13
cd01578149 cd01578, AcnA_Mitochon_Swivel, Mitochondrial aconitase 2e-12
PRK07229646 PRK07229, PRK07229, aconitate hydratase; Validated 4e-68
KOG0453778 KOG0453, KOG0453, KOG0453, Aconitase/homoaconitase (aco 5e-67
TIGR01340745 TIGR01340, aconitase_mito, aconitate hydratase, mitocho 5e-59
TIGR01342658 TIGR01342, acon_putative, aconitate hydratase, putative 1e-59
cd01583382 cd01583, IPMI, 3-isopropylmalate dehydratase catalyzes 5e-43
COG0065423 COG0065, LeuC, 3-isopropylmalate dehydratase large subu 2e-41
TIGR02086412 TIGR02086, IPMI_arch, 3-isopropylmalate dehydratase, la 3e-36
TIGR01343412 TIGR01343, hacA_fam, homoaconitate hydratase family pro 1e-31
TIGR02083419 TIGR02083, LEU2, 3-isopropylmalate dehydratase, large s 2e-31
PRK12466471 PRK12466, PRK12466, isopropylmalate isomerase large sub 4e-27
cd01582363 cd01582, Homoaconitase, Homoaconitase and other unchara 1e-25
TIGR00139712 TIGR00139, h_aconitase, homoaconitase 3e-24
cd01581436 cd01581, AcnB, Aconitate hydratase B catalyses the form 4e-06
TIGR00170465 TIGR00170, leuC, 3-isopropylmalate dehydratase, large s 1e-22
PRK05478466 PRK05478, PRK05478, isopropylmalate isomerase large sub 2e-16
COG1049852 COG1049, AcnB, Aconitase B [Energy production and conve 1e-06
TIGR00117844 TIGR00117, acnB, aconitate hydratase 2 2e-04
cd0040488 cd00404, Aconitase_swivel, Aconitase swivel domain 3e-13
cd0157791 cd01577, IPMI_Swivel, Aconatase-like swivel domain of 3 5e-08
PRK14023166 PRK14023, PRK14023, homoaconitate hydratase small subun 3e-07
COG0066191 COG0066, LeuD, 3-isopropylmalate dehydratase small subu 3e-06
PRK00439163 PRK00439, leuD, 3-isopropylmalate dehydratase small sub 6e-06
PRK14812119 PRK14812, PRK14812, hypothetical protein; Provisional 3e-04
PRK11413751 PRK11413, PRK11413, putative hydratase; Provisional 8e-09
TIGR02087154 TIGR02087, LEUD_arch, 3-isopropylmalate dehydratase, sm 4e-07
PRK09238835 PRK09238, PRK09238, bifunctional aconitate hydratase 2/ 5e-04
>gnl|CDD|35673 KOG0452, KOG0452, KOG0452, RNA-binding translational regulator IRP (aconitase superfamily) [RNA processing and modification, Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181750 PRK09277, PRK09277, aconitate hydratase; Validated Back     alignment and domain information
>gnl|CDD|183810 PRK12881, acnA, aconitate hydratase; Provisional Back     alignment and domain information
>gnl|CDD|162307 TIGR01341, aconitase_1, aconitate hydratase 1 Back     alignment and domain information
>gnl|CDD|185440 PTZ00092, PTZ00092, aconitate hydratase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|177699 PLN00070, PLN00070, aconitate hydratase Back     alignment and domain information
>gnl|CDD|131386 TIGR02333, 2met_isocit_dHY, 2-methylisocitrate dehydratase, Fe/S-dependent Back     alignment and domain information
>gnl|CDD|31249 COG1048, AcnA, Aconitase A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|153136 cd01586, AcnA_IRP, Aconitase A catalytic domain Back     alignment and domain information
>gnl|CDD|144063 pfam00330, Aconitase, Aconitase family (aconitate hydratase) Back     alignment and domain information
>gnl|CDD|153129 cd01351, Aconitase, Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>gnl|CDD|153135 cd01585, AcnA_Bact, Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>gnl|CDD|153134 cd01584, AcnA_Mitochondrial, Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>gnl|CDD|179006 PRK00402, PRK00402, 3-isopropylmalate dehydratase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|29529 cd01580, AcnA_IRP_Swivel, Aconitase A swivel domain Back     alignment and domain information
>gnl|CDD|144335 pfam00694, Aconitase_C, Aconitase C-terminal domain Back     alignment and domain information
>gnl|CDD|29528 cd01579, AcnA_Bact_Swivel, Bacterial Aconitase-like swivel domain Back     alignment and domain information
>gnl|CDD|29527 cd01578, AcnA_Mitochon_Swivel, Mitochondrial aconitase A swivel domain Back     alignment and domain information
>gnl|CDD|180896 PRK07229, PRK07229, aconitate hydratase; Validated Back     alignment and domain information
>gnl|CDD|35674 KOG0453, KOG0453, KOG0453, Aconitase/homoaconitase (aconitase superfamily) [Energy production and conversion, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162306 TIGR01340, aconitase_mito, aconitate hydratase, mitochondrial Back     alignment and domain information
>gnl|CDD|130409 TIGR01342, acon_putative, aconitate hydratase, putative, Aquifex type Back     alignment and domain information
>gnl|CDD|153133 cd01583, IPMI, 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate Back     alignment and domain information
>gnl|CDD|30414 COG0065, LeuC, 3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162691 TIGR02086, IPMI_arch, 3-isopropylmalate dehydratase, large subunit Back     alignment and domain information
>gnl|CDD|130410 TIGR01343, hacA_fam, homoaconitate hydratase family protein Back     alignment and domain information
>gnl|CDD|131138 TIGR02083, LEU2, 3-isopropylmalate dehydratase, large subunit Back     alignment and domain information
>gnl|CDD|183543 PRK12466, PRK12466, isopropylmalate isomerase large subunit; Provisional Back     alignment and domain information
>gnl|CDD|153132 cd01582, Homoaconitase, Homoaconitase and other uncharacterized proteins of the Aconitase family Back     alignment and domain information
>gnl|CDD|129245 TIGR00139, h_aconitase, homoaconitase Back     alignment and domain information
>gnl|CDD|153131 cd01581, AcnB, Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle Back     alignment and domain information
>gnl|CDD|161741 TIGR00170, leuC, 3-isopropylmalate dehydratase, large subunit Back     alignment and domain information
>gnl|CDD|180112 PRK05478, PRK05478, isopropylmalate isomerase large subunit; Validated Back     alignment and domain information
>gnl|CDD|31250 COG1049, AcnB, Aconitase B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|129223 TIGR00117, acnB, aconitate hydratase 2 Back     alignment and domain information
>gnl|CDD|73200 cd00404, Aconitase_swivel, Aconitase swivel domain Back     alignment and domain information
>gnl|CDD|73275 cd01577, IPMI_Swivel, Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins Back     alignment and domain information
>gnl|CDD|184460 PRK14023, PRK14023, homoaconitate hydratase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|30415 COG0066, LeuD, 3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179025 PRK00439, leuD, 3-isopropylmalate dehydratase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|173273 PRK14812, PRK14812, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183125 PRK11413, PRK11413, putative hydratase; Provisional Back     alignment and domain information
>gnl|CDD|162692 TIGR02087, LEUD_arch, 3-isopropylmalate dehydratase, small subunit Back     alignment and domain information
>gnl|CDD|181718 PRK09238, PRK09238, bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 896 aconitate hydratase [Candidatus Liberibacter asiaticus
TIGR01341896 aconitase_1 aconitate hydratase 1; InterPro: IPR006249 100.0
PRK12881896 acnA aconitate hydratase; Provisional 100.0
PRK09277884 aconitate hydratase; Validated 100.0
PTZ00092887 aconitate hydratase; Provisional 100.0
COG1048861 AcnA Aconitase A [Energy production and conversion] 100.0
KOG0452892 consensus 100.0
TIGR02333864 2met_isocit_dHY 2-methylisocitrate dehydratase, Fe/S-de 100.0
PRK07229648 aconitate hydratase; Validated 100.0
PRK11413751 hypothetical protein; Provisional 100.0
TIGR01340761 aconitase_mito aconitate hydratase, mitochondrial; Inte 100.0
KOG0453778 consensus 100.0
TIGR01342658 acon_putative aconitate hydratase, putative; InterPro: 100.0
cd01586404 AcnA_IRP Aconitase A catalytic domain. Aconitase A cata 100.0
cd01584412 AcnA_Mitochondrial Aconitase catalyzes the reversible i 100.0
cd01351389 Aconitase Aconitase catalytic domain; Aconitase catalyz 100.0
cd01585380 AcnA_Bact Aconitase catalyzes the reversible isomerizat 100.0
cd01583382 IPMI 3-isopropylmalate dehydratase catalyzes the isomer 100.0
cd01582363 Homoaconitase Homoaconitase and other uncharacterized p 100.0
pfam00330464 Aconitase Aconitase family (aconitate hydratase). 100.0
PRK12466472 isopropylmalate isomerase large subunit; Provisional 100.0
PRK05478466 isopropylmalate isomerase large subunit; Validated 100.0
PRK00402419 3-isopropylmalate dehydratase large subunit; Reviewed 100.0
TIGR01343432 hacA_fam homoaconitate hydratase family protein; InterP 100.0
TIGR02086431 IPMI_arch 3-isopropylmalate dehydratase, large subunit; 100.0
COG0065423 LeuC 3-isopropylmalate dehydratase large subunit [Amino 100.0
cd01581436 AcnB Aconitate hydratase B catalyses the formation of c 100.0
TIGR00170472 leuC 3-isopropylmalate dehydratase, large subunit; Inte 100.0
TIGR02083419 LEU2 3-isopropylmalate dehydratase, large subunit; Inte 100.0
KOG0454502 consensus 99.88
cd01580171 AcnA_IRP_Swivel Aconitase A swivel domain. This is the 100.0
cd01578149 AcnA_Mitochon_Swivel Mitochondrial aconitase A swivel d 100.0
pfam00694131 Aconitase_C Aconitase C-terminal domain. Members of thi 100.0
cd01579121 AcnA_Bact_Swivel Bacterial Aconitase-like swivel domain 99.97
cd01674129 Homoaconitase_Swivel Homoaconitase swivel domain. This 99.81
TIGR00171194 leuD 3-isopropylmalate dehydratase, small subunit; Inte 97.84
TIGR00139712 h_aconitase homoaconitase; InterPro: IPR004418 Homoacon 100.0
PRK09238841 bifunctional aconitate hydratase 2/2-methylisocitrate d 100.0
COG1049852 AcnB Aconitase B [Energy production and conversion] 100.0
TIGR00117864 acnB aconitate hydratase 2; InterPro: IPR004406 Aconita 99.83
KOG0454502 consensus 100.0
PRK00439163 leuD 3-isopropylmalate dehydratase small subunit; Revie 99.95
TIGR02087159 LEUD_arch 3-isopropylmalate dehydratase, small subunit; 99.92
COG0066191 LeuD 3-isopropylmalate dehydratase small subunit [Amino 99.88
PRK01641201 leuD isopropylmalate isomerase small subunit; Provision 99.71
TIGR02084156 leud 3-isopropylmalate dehydratase, small subunit; Inte 99.39
cd0040488 Aconitase_swivel Aconitase swivel domain. Aconitase (ac 99.93
cd0157791 IPMI_Swivel Aconatase-like swivel domain of 3-isopropyl 99.86
PRK09238841 bifunctional aconitate hydratase 2/2-methylisocitrate d 96.46
COG1049852 AcnB Aconitase B [Energy production and conversion] 93.37
pfam01268555 FTHFS Formate--tetrahydrofolate ligase. 95.36
pfam04412397 DUF521 Protein of unknown function (DUF521). Family of 95.27
cd01355389 AcnX Putative Aconitase X catalytic domain. Putative Ac 94.39
PRK13505556 formate--tetrahydrofolate ligase; Provisional 94.45
pfam06434204 Aconitase_2_N Aconitate hydratase 2 N-terminus. This fa 94.15
COG1679403 Predicted aconitase [General function prediction only] 92.84
COG2759554 MIS1 Formyltetrahydrofolate synthetase [Nucleotide tran 92.04
>TIGR01341 aconitase_1 aconitate hydratase 1; InterPro: IPR006249 Aconitase (aconitate hydratase; 4 Back     alignment and domain information
>PRK12881 acnA aconitate hydratase; Provisional Back     alignment and domain information
>PRK09277 aconitate hydratase; Validated Back     alignment and domain information
>PTZ00092 aconitate hydratase; Provisional Back     alignment and domain information
>COG1048 AcnA Aconitase A [Energy production and conversion] Back     alignment and domain information
>KOG0452 consensus Back     alignment and domain information
>TIGR02333 2met_isocit_dHY 2-methylisocitrate dehydratase, Fe/S-dependent; InterPro: IPR012708 This entry represents Fe/S-dependent 2-methylisocitrate dehydratase (AcnD; 4 Back     alignment and domain information
>PRK07229 aconitate hydratase; Validated Back     alignment and domain information
>PRK11413 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01340 aconitase_mito aconitate hydratase, mitochondrial; InterPro: IPR006248 Aconitase (aconitate hydratase; 4 Back     alignment and domain information
>KOG0453 consensus Back     alignment and domain information
>TIGR01342 acon_putative aconitate hydratase, putative; InterPro: IPR006250 Aconitase (aconitate hydratase; 4 Back     alignment and domain information
>cd01586 AcnA_IRP Aconitase A catalytic domain Back     alignment and domain information
>cd01584 AcnA_Mitochondrial Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>cd01351 Aconitase Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>cd01585 AcnA_Bact Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle Back     alignment and domain information
>cd01583 IPMI 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate Back     alignment and domain information
>cd01582 Homoaconitase Homoaconitase and other uncharacterized proteins of the Aconitase family Back     alignment and domain information
>pfam00330 Aconitase Aconitase family (aconitate hydratase) Back     alignment and domain information
>PRK12466 isopropylmalate isomerase large subunit; Provisional Back     alignment and domain information
>PRK05478 isopropylmalate isomerase large subunit; Validated Back     alignment and domain information
>PRK00402 3-isopropylmalate dehydratase large subunit; Reviewed Back     alignment and domain information
>TIGR01343 hacA_fam homoaconitate hydratase family protein; InterPro: IPR006251 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>TIGR02086 IPMI_arch 3-isopropylmalate dehydratase, large subunit; InterPro: IPR011826 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>COG0065 LeuC 3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd01581 AcnB Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle Back     alignment and domain information
>TIGR00170 leuC 3-isopropylmalate dehydratase, large subunit; InterPro: IPR004430 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>TIGR02083 LEU2 3-isopropylmalate dehydratase, large subunit; InterPro: IPR011823 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>KOG0454 consensus Back     alignment and domain information
>cd01580 AcnA_IRP_Swivel Aconitase A swivel domain Back     alignment and domain information
>cd01578 AcnA_Mitochon_Swivel Mitochondrial aconitase A swivel domain Back     alignment and domain information
>pfam00694 Aconitase_C Aconitase C-terminal domain Back     alignment and domain information
>cd01579 AcnA_Bact_Swivel Bacterial Aconitase-like swivel domain Back     alignment and domain information
>cd01674 Homoaconitase_Swivel Homoaconitase swivel domain Back     alignment and domain information
>TIGR00171 leuD 3-isopropylmalate dehydratase, small subunit; InterPro: IPR004431 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>TIGR00139 h_aconitase homoaconitase; InterPro: IPR004418 Homoaconitase (cis-homoaconitase; 4 Back     alignment and domain information
>PRK09238 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated Back     alignment and domain information
>COG1049 AcnB Aconitase B [Energy production and conversion] Back     alignment and domain information
>TIGR00117 acnB aconitate hydratase 2; InterPro: IPR004406 Aconitase (aconitate hydratase; 4 Back     alignment and domain information
>KOG0454 consensus Back     alignment and domain information
>PRK00439 leuD 3-isopropylmalate dehydratase small subunit; Reviewed Back     alignment and domain information
>TIGR02087 LEUD_arch 3-isopropylmalate dehydratase, small subunit; InterPro: IPR011827 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>COG0066 LeuD 3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01641 leuD isopropylmalate isomerase small subunit; Provisional Back     alignment and domain information
>TIGR02084 leud 3-isopropylmalate dehydratase, small subunit; InterPro: IPR011824 3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4 Back     alignment and domain information
>cd00404 Aconitase_swivel Aconitase swivel domain Back     alignment and domain information
>cd01577 IPMI_Swivel Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins Back     alignment and domain information
>PRK09238 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated Back     alignment and domain information
>COG1049 AcnB Aconitase B [Energy production and conversion] Back     alignment and domain information
>pfam01268 FTHFS Formate--tetrahydrofolate ligase Back     alignment and domain information
>pfam04412 DUF521 Protein of unknown function (DUF521) Back     alignment and domain information
>cd01355 AcnX Putative Aconitase X catalytic domain Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>pfam06434 Aconitase_2_N Aconitate hydratase 2 N-terminus Back     alignment and domain information
>COG1679 Predicted aconitase [General function prediction only] Back     alignment and domain information
>COG2759 MIS1 Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target896 aconitate hydratase [Candidatus Liberibacter asiaticus
2b3x_A888 Structure Of An Orthorhombic Crystal Form Of Human 0.0
2ipy_A888 Crystal Structure Of Iron Regulatory Protein 1 In C 0.0
5acn_A754 Structure Of Activated Aconitase. Formation Of The 1e-156
1aco_A754 Crystal Structure Of Aconitase With Transaconitate 1e-155
1ami_A754 Steric And Conformational Features Of The Aconitase 1e-155
1nis_A754 Crystal Structure Of Aconitase With Trans-Aconitate 1e-155
1c97_A753 S642a:isocitrate Complex Of Aconitase Length = 753 1e-154
1b0j_A754 Crystal Structure Of Aconitase With Isocitrate Leng 1e-154
1c96_A753 S642a:citrate Complex Of Aconitase Length = 753 1e-154
1b0m_A753 Aconitase R644q:fluorocitrate Complex Length = 753 1e-154
2pkp_A170 Crystal Structure Of 3-Isopropylmalate Dehydratase 5e-19
1v7l_A163 Structure Of 3-Isopropylmalate Isomerase Small Subu 3e-14
2hcu_A213 Crystal Structure Of Smu.1381 (Or Leud) From Strept 1e-11
3q3w_A203 Isopropylmalate Isomerase Small Subunit From Campyl 1e-09
3h5j_A171 Leud_1-168 Small Subunit Of Isopropylmalate Isomera 4e-05
3h5h_A189 Leud_1-186 Small Subunit Of Isopropylmalate Isomera 5e-05
3h5e_A159 Leud_1-156 Small Subunit Of Isopropylmalate Isomera 5e-05
1l5j_A865 Crystal Structure Of E. Coli Aconitase B. Length = 2e-07
>gi|88192218|pdb|2B3X|A Chain A, Structure Of An Orthorhombic Crystal Form Of Human Cytosolic Aconitase (Irp1) Length = 888 Back     alignment and structure
 Score = 1105 bits (2859), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/884 (47%), Positives = 586/884 (66%), Gaps = 24/884 (2%)

Query: 22  VYYSLPKAEANGLQGISRLPCSMKVLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESE 81
            +++L K E +      RLP S++VLLE  +R  D   V K+ I   + W   +     E
Sbjct: 19  KFFNLNKLEDS---RYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ-HKNIE 74

Query: 82  VSYRFSRVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGN 141
           V ++ +RV++QDFTGVPAVVD AAMRDA+  LGGDP+ INP+ P DLVIDHS+ VD++  
Sbjct: 75  VPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRR 134

Query: 142 KDAVTRNKDLEYQRNEERYRFLKWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNEN 201
            D++ +N+DLE++RN ER+ FLKWG ++F N R++PPG+GI HQ+NLEYL + V+    +
Sbjct: 135 ADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVF----D 190

Query: 202 GENIAYPDTCVGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSL 261
            +   YPD+ VGTDSHTTMI+ LGILGWGVGGIEAEA MLG PISM+LP+V+G+ + G  
Sbjct: 191 QDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKP 250

Query: 262 QEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFP 321
              VT+TD+VLTIT+ LR+ GVV KFVEFFG G   + +ADRATIANM PEYGAT  FFP
Sbjct: 251 HPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFP 310

Query: 322 VDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDID-YEKVAFTKKMKLDLGNVSPSVA 380
           VD  +I YL  +GR   ++  ++ Y +  GM+R+  D  +   FT+ ++LDL  V P  +
Sbjct: 311 VDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCS 370

Query: 381 GPRRPESRLSLSEVPSSFVTEM--------NEYYKKSHTLDEKYPVKGCDFHLKHGDVAI 432
           GP+RP+ ++++S++   F + +         +   + H   + +     +F L HG V I
Sbjct: 371 GPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVI 430

Query: 433 ASITSCTNTFNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYL 492
           A+ITSCTNT NPSVM+GAGLLA+ AV AGL   P++KTS +PGS V   YL ++G++ YL
Sbjct: 431 AAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYL 490

Query: 493 EALGFSLVGFGCTTCIGNSGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYL 552
             LGF +VG+GC TCIGNSG L + + E I Q  LV  GVLSGNRNFEGR+ P+  ANYL
Sbjct: 491 SQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYL 550

Query: 553 LSPPLVVAYALAGNVRKNLIKDPIGEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKK 612
            SPPLV+AYA+AG +R +  K+P+G + +G  V+L+DIWP   EIQ+   +YV   ++K+
Sbjct: 551 ASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKE 610

Query: 613 KYSDVFKGDSSWWNIEVPESETYMWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLL 672
            Y  +   + SW  +  P  + + W+ KSTY+++PP+FE ++  +     I  A +L  L
Sbjct: 611 VYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNL 670

Query: 673 GDKITTDHISPAGSIPLQSAAASYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICN 732
           GD +TTDHISPAG+I   S AA YL  RG+  ++FN +G+RRGN  VM RGTF+NIR+ N
Sbjct: 671 GDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLN 730

Query: 733 YMLGEEGKKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTR 792
             L    K+   TIH PS E L ++DAA RY+   +PL+V AG EYG GSSRDWAAKG  
Sbjct: 731 RFL---NKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPF 787

Query: 793 LLGVRSVIAESFERIHRSNLIGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQE 852
           LLG+++V+AES+ERIHRSNL+GMGVIP  +  G +   L + G E   I   + + P+ +
Sbjct: 788 LLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMK 847

Query: 853 STLEIHYSDGTFKCVPIICCIDTLDEINHLKNGGILQAVLRQLS 896
             +++     T K    +   DT  E+ +  NGGIL  ++R+++
Sbjct: 848 VQVKLD----TGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMA 887


>gi|126030781|pdb|2IPY|A Chain A, Crystal Structure Of Iron Regulatory Protein 1 In Complex With Ferritin H Ire-Rna Length = 888 Back     alignment and structure
>gi|157837014|pdb|5ACN|A Chain A, Structure Of Activated Aconitase. Formation Of The (4fe-4s) Cluster In The Crystal Length = 754 Back     alignment and structure
>gi|157829802|pdb|1ACO|A Chain A, Crystal Structure Of Aconitase With Transaconitate Bound Length = 754 Back     alignment and structure
>gi|157829964|pdb|1AMI|A Chain A, Steric And Conformational Features Of The Aconitase Mechanism Length = 754 Back     alignment and structure
>gi|157832135|pdb|1NIS|A Chain A, Crystal Structure Of Aconitase With Trans-Aconitate And Nitrocitrate Bound Length = 754 Back     alignment and structure
>gi|5821964|pdb|1C97|A Chain A, S642a:isocitrate Complex Of Aconitase Length = 753 Back     alignment and structure
>gi|6729859|pdb|1B0J|A Chain A, Crystal Structure Of Aconitase With Isocitrate Length = 754 Back     alignment and structure
>gi|5821963|pdb|1C96|A Chain A, S642a:citrate Complex Of Aconitase Length = 753 Back     alignment and structure