254780460

254780460

3-hydroxydecanoyl-(acyl carrier protein) dehydratase

GeneID in NCBI database:8209448Locus tag:CLIBASIA_01725
Protein GI in NCBI database:254780460Protein Accession:YP_003064873.1
Gene range:+(378564, 379082)Protein Length:172aa
Gene description:3-hydroxydecanoyl-(acyl carrier protein) dehydratase
COG prediction:none
KEGG prediction:fabA; 3-hydroxydecanoyl-(acyl carrier protein) dehydratase (EC:4.2.1.60); K01716 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.60]
SEED prediction:3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.60)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT
cccccccccHHHHHHccccccccccccccccccEEEEEEEEEEEccccccccEEEEEEEEccccccHHccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccEEcccccccccEEEEEEEEEEccccccEEEEEEEEEEEccEEEEEEEEEEEEEEcccccc
cccccccEcHHHHHHHHcccccccccccccccccccccEEEEEEcccccccccEEEEEEEcccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEcccccccccEEEEEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEEEcccccc
mknrkssytYEEILRCgegemfgegnaqlpkppmlmFHRITQIsetggnynqgvvraemditpnlwffdchfkndpvmpgclglDALWQLTGFFLGwlgelgkgravsvsnikfrgmvtpdcklveYGIDFKKILRGRVVLgaadgwvkvngkeiyqandlRVCLTIDRGVT
mknrkssytyEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSvsnikfrgmvtpdcKLVEYGIDFKKILRGRVVLGaadgwvkvngkeiyqandlrvcltidrgvt
MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT
******S***EEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTID****
********TYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT
*****SSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTID****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT
MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT
MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
254780770161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus 0.003
>gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 161 Back     alignment
 Score = 33.1 bits (74), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 7/102 (6%)

Query: 60  DITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGW---LGELGKGRAVSVSNIKFRG 116
           ++T N   F  HF   PVMPG L L+ + Q  G          +      +S+   +FR 
Sbjct: 46  NVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRK 105

Query: 117 MVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQA 158
            V P  +L EY ++    +R RV L       KV    + +A
Sbjct: 106 PVFPGDRL-EYHVN---KVRNRVDLWKFQCCAKVENTVVAEA 143

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
315122091172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C 1 6e-79
319403611169 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Ba 1 7e-70
319407996169 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Ba 1 3e-69
49473799169 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [B 1 5e-69
227824080171 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [S 1 6e-69
150398636171 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [S 1 7e-69
319405038169 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Ba 1 3e-68
15964001171 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [S 1 3e-68
49474947169 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [B 1 7e-68
319406528169 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Ba 1 8e-68
>gi|315122091|ref|YP_004062580.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 172 Back     alignment and organism information
 Score =  296 bits (759), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 155/172 (90%)

Query: 1   MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMD 60
           M+NRKSSY+YE+IL CG+GEMFGEGNAQLP PPMLMF+RIT IS+ GG YNQG VRAEMD
Sbjct: 1   MENRKSSYSYEDILSCGQGEMFGEGNAQLPTPPMLMFNRITHISKAGGTYNQGFVRAEMD 60

Query: 61  ITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTP 120
           +TP+LWFF CHFKNDPVMPGCLGLDALWQL GFFLGWLGELG+GRA+SVSNIKFRGMVTP
Sbjct: 61  VTPDLWFFQCHFKNDPVMPGCLGLDALWQLAGFFLGWLGELGRGRAISVSNIKFRGMVTP 120

Query: 121 DCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRGVT 172
            CK++EYGIDFK+I R +VVLGAADGWVKV+G++IY A DLRVCL  +  +T
Sbjct: 121 KCKIIEYGIDFKRISRRQVVLGAADGWVKVDGEKIYTAEDLRVCLYANDELT 172


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319403611|emb|CBI77196.1| 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Bartonella rochalimae ATCC BAA-1498] Length = 169 Back     alignment and organism information
>gi|319407996|emb|CBI81650.1| 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Bartonella schoenbuchensis R1] Length = 169 Back     alignment and organism information
>gi|49473799|ref|YP_031841.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Bartonella quintana str. Toulouse] Length = 169 Back     alignment and organism information
>gi|227824080|ref|YP_002828053.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Sinorhizobium fredii NGR234] Length = 171 Back     alignment and organism information
>gi|150398636|ref|YP_001329103.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Sinorhizobium medicae WSM419] Length = 171 Back     alignment and organism information
>gi|319405038|emb|CBI78648.1| 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Bartonella sp. AR 15-3] Length = 169 Back     alignment and organism information
>gi|15964001|ref|NP_384354.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Sinorhizobium meliloti 1021] Length = 171 Back     alignment and organism information
>gi|49474947|ref|YP_032988.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Bartonella henselae str. Houston-1] Length = 169 Back     alignment and organism information
>gi|319406528|emb|CBI80170.1| 3-hydroxydecanoyl-(acyl-carrier-protein)dehydratase [Bartonella sp. 1-1C] Length = 169 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
PRK05174172 PRK05174, PRK05174, 3-hydroxydecanoyl-(acyl carrier pro 8e-90
TIGR01749169 TIGR01749, fabA, beta-hydroxyacyl-[acyl carrier protein 9e-74
pfam07977133 pfam07977, FabA, FabA-like domain 4e-45
COG0764147 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(ac 3e-33
cd00493131 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carri 1e-22
cd01288131 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl car 7e-12
PRK13188464 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyri 1e-06
cd01287150 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier 4e-42
TIGR01750140 TIGR01750, fabZ, beta-hydroxyacyl-[acyl carrier protein 2e-09
PRK00006147 PRK00006, fabZ, (3R)-hydroxymyristoyl-ACP dehydratase; 1e-05
>gnl|CDD|179953 PRK05174, PRK05174, 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>gnl|CDD|130810 TIGR01749, fabA, beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>gnl|CDD|149192 pfam07977, FabA, FabA-like domain Back     alignment and domain information
>gnl|CDD|31107 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|48029 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>gnl|CDD|48033 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>gnl|CDD|183883 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|48032 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>gnl|CDD|130811 TIGR01750, fabZ, beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>gnl|CDD|178788 PRK00006, fabZ, (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; V 100.0
TIGR01749169 fabA beta-hydroxyacyl-(acyl-carrier-protein) dehydratas 100.0
TIGR01750142 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratas 100.0
PRK13188465 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylgluco 100.0
PRK00006149 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed 100.0
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier 100.0
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (A 100.0
pfam07977133 FabA FabA-like domain. This enzyme domain has a HotDog 100.0
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier prote 100.0
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein 100.0
cd01289138 FabA_like Domain of unknown function, appears to be rel 99.57
COG4706161 Predicted 3-hydroxylacyl-(acyl carrier protein) dehydra 98.69
PRK04424185 fatty acid biosynthesis transcriptional regulator; Prov 94.61
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC ( 97.81
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine oxid 97.46
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydra 97.27
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belongs t 97.18
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein wit 97.17
cd03440100 hot_dog The hotdog fold was initially identified in the 97.12
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fa 96.96
PRK08190 465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 96.82
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to the S 96.54
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA 96.49
pfam01575123 MaoC_dehydratas MaoC like domain. The maoC gene is part 96.45
cd03450149 NodN NodN (nodulation factor N) contains a single hot d 95.85
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisio 94.93
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 94.92
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of th 94.74
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameric acy 90.64
PRK11563676 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase 96.65
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisio 92.58
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisio 91.04
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA; InterPro: IPR010083 This enzyme, FabA, shows overlapping substrate specificity with FabZ with regard to chain length in fatty acid biosynthesis Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ; InterPro: IPR010084 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>pfam07977 FabA FabA-like domain Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>COG4706 Predicted 3-hydroxylacyl-(acyl carrier protein) dehydratase [Lipid metabolism] Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>pfam01575 MaoC_dehydratas MaoC like domain Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
2cf2_C 342 Architecture Of Mammalian Fatty Acid Synthase Lengt 8e-49
2cf2_C342 Architecture Of Mammalian Fatty Acid Synthase Lengt 8e-49
1mkb_A171 Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester D 8e-49
3q62_A175 Crystal Structure Of 3-Hydroxydecanoyl-(Acyl Carrie 2e-48
3b7j_A159 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 7e-20
2gll_A171 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 8e-20
1u1z_A168 The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase ( 2e-19
2glv_A171 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 3e-19
1z6b_A154 Crystal Structure Of Plasmodium Falciparum Fabz At 2e-18
3d6x_A146 Crystal Structure Of Campylobacter Jejuni Fabz Leng 6e-18
2okh_A136 Crystal Structure Of Dimeric Form Of Pffabz In Crys 5e-17
1zhg_A139 Crystal Structure Of Beta-Hydroxyacyl-Acyl Carrier 5e-17
>gi|93279104|pdb|2CF2|C Chain C, Architecture Of Mammalian Fatty Acid Synthase Length = 342 Back     alignment and structure
 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 93/169 (55%), Positives = 121/169 (71%)

Query: 2   KNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDI 61
            +++ SYT E++L  G GE+FG    QLP P MLM  R+ +++ETGGN+++G V AE+DI
Sbjct: 1   VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDI 60

Query: 62  TPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPD 121
            P+LWFF CHF  DPVMPGCLGLDA+WQL GF+LGWLG  GKGRA+ V  +KF G V P 
Sbjct: 61  NPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPT 120

Query: 122 CKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTIDRG 170
            K V Y I FK+I+  R+++G ADG V V+G+ IY A+DL+V L  D  
Sbjct: 121 AKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTS 169


>gi|93279104|pdb|2CF2|C Chain C, Architecture Of Mammalian Fatty Acid Synthase Length = 342 Back     alignment and structure
>gi|1633163|pdb|1MKB|A Chain A, Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester Dehydrase At Ph 5 And 21 Degrees C Length = 171 Back     alignment and structure
>gi|317455542|pdb|3Q62|A Chain A, Crystal Structure Of 3-Hydroxydecanoyl-(Acyl Carrier Protein) Dehydratase From Yersinia Pestis Length = 175 Back     alignment and structure
>gi|197725029|pdb|3B7J|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) From Helicobacter Pylori Complexed With Juglone Length = 159 Back     alignment and structure
>gi|145579403|pdb|2GLL|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) From Helicobacter Pylori Length = 171 Back     alignment and structure
>gi|55670131|pdb|1U1Z|A Chain A, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz) Length = 168 Back     alignment and structure
>gi|145579421|pdb|2GLV|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori Length = 171 Back     alignment and structure
>gi|71042184|pdb|1Z6B|A Chain A, Crystal Structure Of Plasmodium Falciparum Fabz At 2.1 A Length = 154 Back     alignment and structure
>gi|229597707|pdb|3D6X|A Chain A, Crystal Structure Of Campylobacter Jejuni Fabz Length = 146 Back     alignment and structure
>gi|146387615|pdb|2OKH|A Chain A, Crystal Structure Of Dimeric Form Of Pffabz In Crystal Form3 Length = 136 Back     alignment and structure
>gi|109156958|pdb|1ZHG|A Chain A, Crystal Structure Of Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (Fabz) From Plasmodium Falciparum Length = 139 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
1mka_A171 Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid 5e-53
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty acid 8e-53
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty acid 1e-45
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydr 3e-18
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratas 5e-16
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, beta-hyd 4e-15
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 1e-14
3esi_A129 Uncharacterized protein; protein from erwinia carotovor 3e-16
>1mka_A Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli} SCOP: d.38.1.2 PDB: 1mkb_A Length = 171 Back     alignment and structure
 Score =  202 bits (514), Expect = 5e-53
 Identities = 93/166 (56%), Positives = 121/166 (72%)

Query: 3   NRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDIT 62
           +++ SYT E++L  G GE+FG    QLP P MLM  R+ +++ETGGN+++G V AE+DI 
Sbjct: 2   DKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDIN 61

Query: 63  PNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDC 122
           P+LWFF CHF  DPVMPGCLGLDA+WQL GF+LGWLG  GKGRA+ V  +KF G V P  
Sbjct: 62  PDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTA 121

Query: 123 KLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTID 168
           K V Y I FK+I+  R+++G ADG V V+G+ IY A+DL+V L  D
Sbjct: 122 KKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQD 167


>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Length = 342 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Length = 342 Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Length = 171 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Length = 168 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 1zhg_A 2oki_A 2okh_A Length = 154 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Length = 146 Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
1mka_A171 Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid 100.0
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty acid 100.0
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty acid 100.0
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, beta-hyd 100.0
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydr 100.0
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 100.0
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratas 100.0
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, 97.21
2qwz_A159 Phenylacetic acid degradation-related protein; putative 96.05
1vh9_A149 P15, hypothetical protein YBDB; structural genomics, un 95.46
1o0i_A138 Hypothetical protein HI1161; structural genomics, PSI, 94.47
1vh5_A148 Hypothetical protein YDII; PSI, protein structure initi 94.34
3esi_A129 Uncharacterized protein; protein from erwinia carotovor 99.87
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene regulat 98.75
2pim_A141 Phenylacetic acid degradation-related protein; thioeste 97.11
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hydrola 96.82
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, st 96.38
1zki_A133 Hypothetical protein PA5202; structural genomics, PSI, 96.09
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, struct 95.79
2h4u_A145 Thioesterase superfamily member 2; structural genomics, 95.74
3hrq_A357 PKS, aflatoxin biosynthesis polyketide synthase; hot-DO 95.46
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA 95.23
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA 95.17
1wlu_A136 PAAI protein, phenylacetic acid degradation protein PAA 94.8
2hbo_A158 Hypothetical protein (NP_422103.1); structural genomics 93.57
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics, unk 93.3
3nwz_A176 BH2602 protein; structural genomics, PSI-2, protein str 91.97
2cwz_A141 Thioesterase family protein; structural genomics, NPPSF 91.36
1q6w_A161 Monoamine oxidase regulatory protein, putative; structu 97.93
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhy 97.41
2b3n_A159 Hypothetical protein AF1124; structural genomics, PSI, 97.23
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, str 97.16
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural proteomics 97.09
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural 96.85
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetical, ho 96.19
3kg6_A285 CURF; polyketide synthase, double hotdog fold, dehydrat 92.57
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Ph 91.03
>1mka_A Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli} SCOP: d.38.1.2 PDB: 1mkb_A Back     alignment and structure
Probab=100.00  E-value=0  Score=375.05  Aligned_cols=169  Identities=55%  Similarity=1.069  Sum_probs=164.1

Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCEEEHH
Q ss_conf             88865589889998418835579988899864122568999971844134235788750786553004556899521127
Q gi|254780460|r    2 KNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGC   81 (172)
Q Consensus         2 ~~~~~~f~~~~i~~~~~g~~fg~~~~rLP~~p~lmiDrV~~i~~~~g~~g~G~i~aek~i~~d~wff~gHFp~~PvmPGv   81 (172)
                      +++|+|||+|||+|||+|++|||.++|||+|||||||||+++++++|.+++|+++|+|+|++|||||+||||++||||||
T Consensus         1 ~~~~~~~~~~~ll~~~~g~~fg~~~~rLP~~P~L~iDrV~~i~~~~~~~~~g~i~a~k~v~~de~ff~gHFp~~PvmPGv   80 (171)
T 1mka_A            1 VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGC   80 (171)
T ss_dssp             CCCCSCBCHHHHHHHHTTCSSCSSSCCCCCTTTCCCSEEEEEESSCTTTTSCEEEEEEECCTTSGGGGTTTTTSCCCCHH
T ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCCCCEEEEEEECCCCCCEEEECCCCCCCCCHH
T ss_conf             98667899999997469966789988799997282899799974788456655999994255677784068999688779


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCEEEEEECCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCEEEEEEEEE
Q ss_conf             57888799886401233468826676304511410233798579999998896307857999999999999999999710
Q gi|254780460|r   82 LGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDL  161 (172)
Q Consensus        82 L~iEa~~Ql~~~~~~~~~~~~~~~~~~~~~vkfr~~V~Pgd~~i~~~i~ik~v~~~~~~~~~~~g~~~vdg~~i~~a~~l  161 (172)
                      |++|||+|++++++++.+.....++++++++|||++|+|||++++|+++++++.++++.+++++|+++|||++||+|+++
T Consensus        81 L~iEa~aQ~~~~~~~~~~~~~~~~~~~i~~~kfr~~V~Pgd~l~~~~v~i~~i~~~~~~~~~~~g~~~vdgk~v~~a~~~  160 (171)
T 1mka_A           81 LGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDL  160 (171)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCSEEEEEEESCEEECSCCCTTCCEEEEEEEEEEEEESSSEEEEEEEEEEETTEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHEECCCCCCEEEEECCCCEEECCCCCCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCEEEEEEECC
T ss_conf             99999999999985403789847887424015866407999899999999999735847999999999899999999477


Q ss_pred             EEEEECCCC
Q ss_conf             699861768
Q gi|254780460|r  162 RVCLTIDRG  170 (172)
Q Consensus       162 ~vgl~~de~  170 (172)
                      +|+||+|++
T Consensus       161 ~v~~f~~~~  169 (171)
T 1mka_A          161 KVGLFQDTS  169 (171)
T ss_dssp             EEEEESCCT
T ss_pred             EEEEEECCC
T ss_conf             999871777



>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown function; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: d.38.1.5 Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural genomics, joint center for structural genomics, JCSG; 1.50A {Shewanella loihica pv-4} Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3hrq_A PKS, aflatoxin biosynthesis polyketide synthase; hot-DOG fold, iterative type I PKS, norsolorinic acid, product template domain; HET: PLM; 1.80A {Aspergillus parasiticus} PDB: 3hrr_A* Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, structural genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, unknown function; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Thermus thermophilus HB8} SCOP: d.38.1.7 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304} SCOP: d.38.1.4 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structural genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3kg6_A CURF; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.70A {Lyngbya majuscula} Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
d1mkaa_171 d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase 4e-45
d1u1za_145 d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ 2e-15
d1z6ba1146 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase 2e-14
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: beta-Hydroxydecanol thiol ester dehydrase
domain: beta-Hydroxydecanol thiol ester dehydrase
species: Escherichia coli [TaxId: 562]
 Score =  174 bits (442), Expect = 4e-45
 Identities = 92/163 (56%), Positives = 120/163 (73%)

Query: 3   NRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDIT 62
           +++ SYT E++L  G GE+FG    QLP P MLM  R+ +++ETGGN+++G V AE+DI 
Sbjct: 2   DKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDIN 61

Query: 63  PNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDC 122
           P+LWFF CHF  DPVMPGCLGLDA+WQL GF+LGWLG  GKGRA+ V  +KF G V P  
Sbjct: 62  PDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTA 121

Query: 123 KLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCL 165
           K V Y I FK+I+  R+++G ADG V V+G+ IY A+DL+V L
Sbjct: 122 KKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGL 164


>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Length = 145 Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 146 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escherichia 100.0
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria paras 100.0
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas a 100.0
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus horiko 96.82
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId: 562 96.34
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenzae [Ta 94.42
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId: 562 91.74
d2f41a1111 Transcription factor FapR, C-terminal domain {Bacillus 98.67
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tuberculosis 97.23
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginosa [Ta 95.4
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentus [Ta 95.13
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional peroxis 94.34
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional peroxis 94.2
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermus the 93.88
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escherichia 93.21
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [TaxId 93.08
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilus [Ta 92.76
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Archaeog 97.79
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae [Tax 97.16
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 97.03
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobus ful 96.51
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 96.1
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional peroxis 90.84
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: beta-Hydroxydecanol thiol ester dehydrase
domain: beta-Hydroxydecanol thiol ester dehydrase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=373.79  Aligned_cols=169  Identities=55%  Similarity=1.069  Sum_probs=163.7

Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCEEEHH
Q ss_conf             88865589889998418835579988899864122568999971844134235788750786553004556899521127
Q gi|254780460|r    2 KNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGC   81 (172)
Q Consensus         2 ~~~~~~f~~~~i~~~~~g~~fg~~~~rLP~~p~lmiDrV~~i~~~~g~~g~G~i~aek~i~~d~wff~gHFp~~PvmPGv   81 (172)
                      +++|+|||+|||+|||+|++|||.++|||.|||||||||+++++++|.+++|+++|+|+|++|||||+||||++||||||
T Consensus         1 ~~~~~~~~~~~ll~~a~g~~fg~~~~rlP~~P~L~iDrV~~i~~~~g~~~~g~i~~~k~v~~~ewff~gHFp~~PvmPGv   80 (171)
T d1mkaa_           1 VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGC   80 (171)
T ss_dssp             CCCCSCBCHHHHHHHHTTCSSCSSSCCCCCTTTCCCSEEEEEESSCTTTTSCEEEEEEECCTTSGGGGTTTTTSCCCCHH
T ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCEEEEEEECCCCCCEECCCCCCCCCCCHH
T ss_conf             98556899999996358970799988899998786999999728987215423588971235565024556686739889


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCEEEEEECCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCEEEEEEEEE
Q ss_conf             57888799886401233468826676304511410233798579999998896307857999999999999999999710
Q gi|254780460|r   82 LGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDL  161 (172)
Q Consensus        82 L~iEa~~Ql~~~~~~~~~~~~~~~~~~~~~vkfr~~V~Pgd~~i~~~i~ik~v~~~~~~~~~~~g~~~vdg~~i~~a~~l  161 (172)
                      |++|||+|++++++++.+.....++++++++|||++|+|||++++|+++++++.++++++++++|+++|||++||+|+++
T Consensus        81 L~iEa~aQ~~~~l~~~~~~~~~~~~~~i~~~kfr~~V~Pgd~l~~~~i~~~~i~~~~~~~~~~~g~~~Vdgk~v~ea~~~  160 (171)
T d1mkaa_          81 LGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDL  160 (171)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCSEEEEEEESCEEECSCCCTTCCEEEEEEEEEEEEESSSEEEEEEEEEEETTEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHEECCCCCCEEEEECCEEEEECCCCCCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCEEEEEEECC
T ss_conf             99999999986861522779836786154606844322798089999999998743748999999999899999999477


Q ss_pred             EEEEECCCC
Q ss_conf             699861768
Q gi|254780460|r  162 RVCLTIDRG  170 (172)
Q Consensus       162 ~vgl~~de~  170 (172)
                      +||||++++
T Consensus       161 ~vglf~~~~  169 (171)
T d1mkaa_         161 KVGLFQDTS  169 (171)
T ss_dssp             EEEEESCCT
T ss_pred             EEEEEECCC
T ss_conf             999885677



>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata
1mka_A_171 (A:) Beta-hydroxydecanoyl thiol ester dehydrase; f 3e-43
2cf2_C_ 342 (C:) Fatty acid synthase, DH domain; transferase, 1e-36
2cf2_C_342 (C:) Fatty acid synthase, DH domain; transferase, 6e-33
1u1z_A_168 (A:) (3R)-hydroxymyristoyl-[acyl carrier protein] 3e-28
1z6b_A_154 (A:) Pffabz, fatty acid synthesis protein; malaria 1e-27
3esi_A_129 (A:) Uncharacterized protein; protein from erwinia 2e-27
3d6x_A_146 (A:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] 6e-25
2gll_A_171 (A:) FABZ, (3R)-hydroxymyristoyl-acyl carrier prot 2e-24
1q6w_A_161 (A:) Monoamine oxidase regulatory protein, putativ 6e-05
2bi0_A_176-337162 (A:176-337) Hypothetical protein RV0216; conserved 2e-04
>1mka_A (A:) Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli}Length = 171 Back     alignment and structure
 Score =  169 bits (428), Expect = 3e-43
 Identities = 92/163 (56%), Positives = 120/163 (73%)

Query: 3   NRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDIT 62
           +++ SYT E++L  G GE+FG    QLP P MLM  R+ +++ETGGN+++G V AE+DI 
Sbjct: 2   DKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDIN 61

Query: 63  PNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDC 122
           P+LWFF CHF  DPVMPGCLGLDA+WQL GF+LGWLG  GKGRA+ V  +KF G V P  
Sbjct: 62  PDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTA 121

Query: 123 KLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCL 165
           K V Y I FK+I+  R+++G ADG V V+G+ IY A+DL+V L
Sbjct: 122 KKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGL 164


>2cf2_C (C:) Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa}Length = 342 Back     alignment and structure
>2cf2_C (C:) Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa}Length = 342 Back     alignment and structure
>1u1z_A (A:) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa}Length = 168 Back     alignment and structure
>1z6b_A (A:) Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum}Length = 154 Back     alignment and structure
>3esi_A (A:) Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum}Length = 129 Back     alignment and structure
>3d6x_A (A:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp}Length = 146 Back     alignment and structure
>2gll_A (A:) FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A*Length = 171 Back     alignment and structure
>1q6w_A (A:) Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304}Length = 161 Back     alignment and structure
>2bi0_A (A:176-337) Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis}Length = 162 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [C
2cf2_C_342 Fatty acid synthase, DH domain; transferase, fatty 100.0
2cf2_C_ 342 Fatty acid synthase, DH domain; transferase, fatty 100.0
1mka_A_171 Beta-hydroxydecanoyl thiol ester dehydrase; fatty 100.0
1z6b_A_154 Pffabz, fatty acid synthesis protein; malaria, bet 100.0
2gll_A_171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 100.0
1u1z_A_168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 99.97
3d6x_A_146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd 99.97
2prx_A_160 Thioesterase superfamily protein; ZP_00837258.1, s 99.07
2bi0_A_176-337162 Hypothetical protein RV0216; conserved hypothetica 98.99
2qwz_A_159 Phenylacetic acid degradation-related protein; YP_ 98.68
1ixl_A_131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 98.46
3f1t_A_148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 98.34
2h4u_A_145 Thioesterase superfamily member 2; structural geno 98.19
1o0i_A_138 Hypothetical protein HI1161; structural genomics, 96.99
3esi_A_129 Uncharacterized protein; protein from erwinia caro 99.96
1q6w_A_161 Monoamine oxidase regulatory protein, putative; st 98.63
2f3x_A_40-157118 Transcription factor FAPR; 'HOT-DOG' fold / malony 98.29
2f41_A_121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 98.12
2cwz_A_141 Thioesterase family protein; structural genomics, 97.63
2hbo_A_158 Hypothetical protein (NP_422103.1); structural gen 97.48
2pim_A_141 Phenylacetic acid degradation-related protein; YP_ 97.43
2c2i_A_151 RV0130; hotdog, hydratase, lyase, structural prote 97.31
1yoc_A_147 Hypothetical protein PA1835; structural genomics, 97.23
2fs2_A_151 Phenylacetic acid degradation protein PAAI; operon 96.91
2uv8_G_1261-1643383 Fatty acid synthase subunit beta (FAS1); fatty aci 96.72
3gek_A_146 Putative thioesterase YHDA; X-RAY, structure genom 96.64
1zki_A_133 Hypothetical protein PA5202; structural genomics, 96.54
3f5o_A_148 Thioesterase superfamily member 2; hotdog fold, hy 96.46
1wlu_A_136 PAAI protein, phenylacetic acid degradation protei 95.76
3kg8_A_308 CURJ; polyketide synthase, double hotdog fold, deh 95.26
3kg7_A_293 CURH; polyketide synthase, double hotdog fold, deh 95.25
2ov9_A_216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 94.88
3e29_A_144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 94.66
1q4t_A_151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 94.58
2eis_A_133 Hypothetical protein TTHB207; COA binding motif, N 93.19
1sh8_A_154 Hypothetical protein PA5026; structural genomics, 91.37
1vh9_A_149 P15, hypothetical protein YBDB; structural genomic 91.29
3e8p_A_164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 91.19
3ir3_A_148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 98.34
1iq6_A_134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 98.15
2b3n_A_159 Hypothetical protein AF1124; structural genomics, 98.0
2uva_G_1283-1670388 Fatty acid synthase beta subunits; fungal, dehydra 97.31
3exz_A_154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 96.74
2bi0_A_1-175175 Hypothetical protein RV0216; conserved hypothetica 96.45
1s9c_A_298 Peroxisomal multifunctional enzyme type 2; hot-DOG 95.54
3khp_A_311 MAOC family protein; ssgcid, NIH, niaid, decode, u 95.36
1pn2_A_280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 95.32
3kg6_A_ 285 CURF; polyketide synthase, double hotdog fold, deh 94.63
2vz8_A_833-1109 277 Fatty acid synthase; transferase, phosphopantethei 93.45
3kg9_A_ 296 CURK; polyketide synthase, double hotdog fold, deh 93.43
3kg7_A_ 293 CURH; polyketide synthase, double hotdog fold, deh 93.06
>2cf2_C (C:) Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} Back     alignment and structure
Probab=100.00  E-value=0  Score=338.39  Aligned_cols=168  Identities=55%  Similarity=1.079  Sum_probs=121.2

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCEEEHHH
Q ss_conf             88655898899984188355799888998641225689999718441342357887507865530045568995211275
Q gi|254780460|r    3 NRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCL   82 (172)
Q Consensus         3 ~~~~~f~~~~i~~~~~g~~fg~~~~rLP~~p~lmiDrV~~i~~~~g~~g~G~i~aek~i~~d~wff~gHFp~~PvmPGvL   82 (172)
                      .++.++++++++++++|++|++..+|||++||||||||+++++++|++++|+++|+|+|++|||||+||||++|||||||
T Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~~~Lp~~p~l~iDrv~~i~~~~g~~~~g~i~a~k~v~~dewff~gHf~~~PvmPG~L  252 (342)
T 2cf2_C          173 DKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCL  252 (342)
T ss_pred             CCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCCCCEEEEEEECCCCCCEECCCCCCCEECCCHH
T ss_conf             55666560210013453114799888899872317889999169983235369999842766544737898870746189


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEEECCCEEEEEECCCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCEEEEEEEEEE
Q ss_conf             78887998864012334688266763045114102337985799999988963078579999999999999999997106
Q gi|254780460|r   83 GLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLR  162 (172)
Q Consensus        83 ~iEa~~Ql~~~~~~~~~~~~~~~~~~~~~vkfr~~V~Pgd~~i~~~i~ik~v~~~~~~~~~~~g~~~vdg~~i~~a~~l~  162 (172)
                      ++|||+|++++++.+.+.+...++.++++||||++|+|||++++|+++|+++..++.++++++|+++|||++||++++++
T Consensus       253 ~iEa~~Q~~~~~~~~~~~~~~~~~~~~~~vkfr~~V~Pgd~~l~~~~~i~~v~~~~~~~~~~~g~~~vdg~~i~~~~~~~  332 (342)
T 2cf2_C          253 GLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLK  332 (342)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEECCCCEEEEEEECCCEEEEEEEEEEEEEECCCEEEEEEEEEEECCEEEEEEEEEE
T ss_conf             99999999877630136788157710576289358706998999999999975078259999999999999999998349


Q ss_pred             EEEECCCC
Q ss_conf             99861768
Q gi|254780460|r  163 VCLTIDRG  170 (172)
Q Consensus       163 vgl~~de~  170 (172)
                      +++++|+.
T Consensus       333 ~~~~~~~~  340 (342)
T 2cf2_C          333 VGLFQDTS  340 (342)
T ss_pred             EEEEECCC
T ss_conf             99994677



>2cf2_C (C:) Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} Back     alignment and structure
>1mka_A (A:) Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli} Back     alignment and structure
>1z6b_A (A:) Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} Back     alignment and structure
>2gll_A (A:) FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>1u1z_A (A:) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3d6x_A (A:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>2prx_A (A:) Thioesterase superfamily protein; ZP_00837258.1, structural genomics, joint center for structural genomics, JCSG; 1.50A {Shewanella loihica pv-4} Back     alignment and structure
>2bi0_A (A:176-337) Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} Back     alignment and structure
>2qwz_A (A:) Phenylacetic acid degradation-related protein; YP_613385.1, putative thioesterase, structural genomics, joint center for structural genomics; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1ixl_A (A:) Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown function; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3f1t_A (A:) Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2h4u_A (A:) Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3esi_A (A:) Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>1q6w_A (A:) Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2f3x_A (A:40-157) Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} Back     alignment and structure
>2f41_A (A:) Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} Back     alignment and structure
>2cwz_A (A:) Thioesterase family protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Thermus thermophilus HB8} Back     alignment and structure
>2hbo_A (A:) Hypothetical protein (NP_422103.1); structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PE4; 1.85A {Caulobacter vibrioides} Back     alignment and structure
>2pim_A (A:) Phenylacetic acid degradation-related protein; YP_298971.1, thioesterase superfamily, structural genomics; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2c2i_A (A:) RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} Back     alignment and structure
>1yoc_A (A:) Hypothetical protein PA1835; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2fs2_A (A:) Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3gek_A (A:) Putative thioesterase YHDA; X-RAY, structure genomics, NESG, KR113, Q9CHK5_lacla, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>1zki_A (A:) Hypothetical protein PA5202; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3f5o_A (A:) Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1wlu_A (A:) PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, structural genomics; 1.45A {Thermus thermophilus HB8} Back     alignment and structure
>3kg8_A (A:) CURJ; polyketide synthase, double hotdog fold, dehydratase; 2.45A {Lyngbya majuscula} Back     alignment and structure
>3kg7_A (A:) CURH; polyketide synthase, double hotdog fold, dehydratase; 2.77A {Lyngbya majuscula} Back     alignment and structure
>2ov9_A (A:) Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Rhodococcus SP} Back     alignment and structure
>3e29_A (A:) Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella bronchiseptica} Back     alignment and structure
>1q4t_A (A:) Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} Back     alignment and structure
>2eis_A (A:) Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein structural and functional analyses; HET: COA; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>1sh8_A (A:) Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1vh9_A (A:) P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} Back     alignment and structure
>3e8p_A (A:) Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure