254780461

254780461

3-oxoacyl-(acyl carrier protein) synthase I

GeneID in NCBI database:8209449Locus tag:CLIBASIA_01730
Protein GI in NCBI database:254780461Protein Accession:YP_003064874.1
Gene range:+(379126, 380346)Protein Length:406aa
Gene description:3-oxoacyl-(acyl carrier protein) synthase I
COG prediction:[I] [Q] 3-oxoacyl-(acyl-carrier-protein) synthase
KEGG prediction:fabB; 3-oxoacyl-(acyl carrier protein) synthase I (EC:2.3.1.41); K00647 3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
SEED prediction:3-oxoacyl-[acyl-carrier-protein] synthase, KASI (EC 2.3.1.41)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
cccEEEEEEEEEccccccHHHHHHHHHccccccEEcccccccccccEEcccccccHHHcccHHHHHHccHHHHHHHHHHHHHHHHccccHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHccccEEEEccHHHHcHHHHHHHHHHHHHcccccccccccccccccccccEEEEccEEEEEEEEHHHHHHccccEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHcccccEEEEEHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEEEEccc
cccEEEEEEEEEEccEccHHHHHHHHHHccccEEEcHHHHHHcccccEEEcccccccccccHHHHccccHHHHHHHHHHHHHHHHHcccHcHcccccEEEEEEcccccHHHHHHHHHHHcccccHHHHcccHHHHHcccHHHHHHHccccccccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHcccEcccccccHHHcccccEcccccEcEEcEEEEEEEEEHHHHHHccccccEEEEEEEEEEccccccccccHHHHHHHHHHHccccccccEEEccccccHHHHHHHHHHHHHHHcccccEEEccHHHHcEcHHHHHHHHHHHHHHHHHHcEEccccccccEcHHHccccEccccEEcccccEEEEEEEEcccEEEEEEEEcccc
MRRVAVTGMGIVSSIGNNVSEVAISLRearsgitfsedfakfgfrcqvwgkpllnAAELIDRKAMRFlsqggtwghLAMQEAitdsrlqpceithertgliagsggpstKCIVSAAdltrehcstrrigpfavpkamsstasATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDimfaggqedldWTMSNLFDAMGAmsshfnhdpcsasrpydsrrdgfvisGGAAVIVLEEMERAKARGAKIYAELTgygstcdgddmvspsgeGAIRCMRQALssveepvdyinthgtatpkgdkKEVEAIREVFKgnipyiqstksltghslgaagAQEAIYCLIMMQErfigesknieeidpefkgipivrkridnakidtvlsnsfgfggtnATLVFRRYKG
mrrvavtgmgivssignnvSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERtgliagsggpsTKCIVSAADLTREHCSTRRIGpfavpkamsstaSATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINThgtatpkgdkkeVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGEsknieeidpefkGIPIVRKRIDNAKIdtvlsnsfgfggtnatLVFRRYKG
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKamsstasatlstWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK*
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVP********ATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
*RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target406 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
254780533423 3-oxoacyl-(acyl carrier protein) synthase II [Cand 5e-63
>gi|254780533|ref|YP_003064946.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score =  233 bits (593), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 234/424 (55%), Gaps = 23/424 (5%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGIT-FSEDFAKFGFRCQVWGK-PL----- 53
           MRRV VTG+G+++ +G  V      L     GI    + F   G   ++ G  P+     
Sbjct: 1   MRRVVVTGLGMITPLGCGVDVSWSRLIAGEVGIRHLDQKFDLEGLSSKIAGLIPVGNGSD 60

Query: 54  --LNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTK 110
              N  + I    +R + Q   +G +A   A+ DS   P  +     TG++ GSG     
Sbjct: 61  GTFNYEDWILSSDLRKIDQFILYGMVASDMALADSGWAPKTDKDRNSTGVVFGSGMGGLN 120

Query: 111 CIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIG 170
            IV ++++ R+    R+I PF VP ++ S  S  +S   ++RG ++++++AC++ AH IG
Sbjct: 121 RIVESSNVLRDG-GPRKISPFTVPGSIISLLSGNISIRNQLRGPNHAVTTACSSGAHAIG 179

Query: 171 NAAELIQSGKQDIMFAGGQEDLDWTMSNL-FDAMGAMSSHFNHDPCSASRPYDSRRDGFV 229
           +A+ LI  G  D+M AGG E     +    F A  A+S+ FN DP  ASRP+D  RDGFV
Sbjct: 180 DASRLIAFGDADVMVAGGAEAPICRLGVASFAACRALSTRFNDDPTRASRPFDQDRDGFV 239

Query: 230 ISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSP--SGEGAIRCMRQALSS- 286
           +  GA  +VLE++E AKARGAKIY+E+ GYG + D   +  P   G GA RCM  A++  
Sbjct: 240 MGEGAGALVLEDLEHAKARGAKIYSEIIGYGLSGDAFHITMPPEDGNGAYRCMSSAIARA 299

Query: 287 --VEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYI--QSTKSLTGHSLGAAGAQEA 342
             +   +DYIN HGT+T   D  E+ A+  +   +  ++   STKS  GH LGAAGA EA
Sbjct: 300 KLLPSDIDYINAHGTST-IADTIELGAVERLMGDSCYHVSMSSTKSAMGHLLGAAGAVEA 358

Query: 343 IYCLIMMQERFIGESKNIEEIDPEFKG-IPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
             C + +++  +  + N++  +P  K  I +V  R     ++  +SNSFGFGGTN +LVF
Sbjct: 359 AICNLAIRDGIVPATLNLD--NPAKKTFIDLVPHRAIKKNVNVAMSNSFGFGGTNVSLVF 416

Query: 402 RRYK 405
           R+++
Sbjct: 417 RKFQ 420

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target406 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
315122090406 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus 1 0.0
15964000406 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizob 1 0.0
222084316407 3-oxoacyl-(acyl-carrier-protein) synthase I protein [Ag 1 0.0
227824079406 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizob 1 0.0
150398635406 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizob 1 1e-180
163757758407 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phot 1 1e-180
222147156407 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacter 1 1e-180
325291592407 3-oxoacyl-acyl carrier protein synthase I [Agrobacteriu 1 1e-180
110636262406 3-oxoacyl-(acyl carrier protein) synthase I [Mesorhizob 1 1e-180
159184184407 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacter 1 1e-178
>gi|315122090|ref|YP_004062579.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 406 Back     alignment and organism information
 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/406 (85%), Positives = 379/406 (93%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR+AVTGMGIVSSIGNNVSEVA +L +A+SGITFSEDFA+ GFRCQVWGKP LN AEL+
Sbjct: 1   MRRIAVTGMGIVSSIGNNVSEVATALWKAQSGITFSEDFARLGFRCQVWGKPDLNEAELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRFLSQGG WGH+AMQ+AI DS L   EITHERTGLI GSGGPSTKCIV +A LT+
Sbjct: 61  DRKAMRFLSQGGMWGHIAMQQAIADSGLDQSEITHERTGLIVGSGGPSTKCIVDSAQLTQ 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           EH +TRR+GPFAVPKAMSSTASA LSTWFKI GTSYSISSAC+TSAHCIGNAAELIQSGK
Sbjct: 121 EHLNTRRVGPFAVPKAMSSTASANLSTWFKILGTSYSISSACSTSAHCIGNAAELIQSGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFN +P +ASRPYDS+RDGFVISGGAA++V+E
Sbjct: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNDNPRAASRPYDSQRDGFVISGGAAILVME 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           EMERAKARGAKIYAEL+GYGSTCDG DMVSPSGEGA+RCMRQALSSV+ P+DYINTHGTA
Sbjct: 241 EMERAKARGAKIYAELSGYGSTCDGCDMVSPSGEGAVRCMRQALSSVQNPIDYINTHGTA 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GDKKE+EAI+EVFK +IP+IQSTKSLTGHSLGAAGAQEAIY LIMMQ+ FIGESKNI
Sbjct: 301 TLIGDKKEIEAIKEVFKDDIPHIQSTKSLTGHSLGAAGAQEAIYSLIMMQKNFIGESKNI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EEIDPEFKG+PIVRKRIDN +IDTVLSNSFGFGGTNATLVF+RYKG
Sbjct: 361 EEIDPEFKGLPIVRKRIDNVQIDTVLSNSFGFGGTNATLVFQRYKG 406


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964000|ref|NP_384353.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium meliloti 1021] Length = 406 Back     alignment and organism information
>gi|222084316|ref|YP_002542845.1| 3-oxoacyl-(acyl-carrier-protein) synthase I protein [Agrobacterium radiobacter K84] Length = 407 Back     alignment and organism information
>gi|227824079|ref|YP_002828052.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium fredii NGR234] Length = 406 Back     alignment and organism information
>gi|150398635|ref|YP_001329102.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium medicae WSM419] Length = 406 Back     alignment and organism information
>gi|163757758|ref|ZP_02164847.1| 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phototrophica DFL-43] Length = 407 Back     alignment and organism information
>gi|222147156|ref|YP_002548113.1| 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacterium vitis S4] Length = 407 Back     alignment and organism information
>gi|325291592|ref|YP_004277456.1| 3-oxoacyl-acyl carrier protein synthase I [Agrobacterium sp. H13-3] Length = 407 Back     alignment and organism information
>gi|110636262|ref|YP_676470.1| 3-oxoacyl-(acyl carrier protein) synthase I [Mesorhizobium sp. BNC1] Length = 406 Back     alignment and organism information
>gi|159184184|ref|NP_353185.2| 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacterium tumefaciens str. C58] Length = 407 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target406 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
PRK07967406 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) sy 0.0
cd00834406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein ( 1e-114
PRK07314411 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) sy 1e-104
TIGR03150407 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein syn 1e-101
KOG1394440 KOG1394, KOG1394, KOG1394, 3-oxoacyl-(acyl-carrier-prot 5e-88
PRK06333424 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) sy 3e-85
PTZ00050421 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synt 5e-84
PRK08439406 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) sy 9e-77
PLN02836437 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] sy 2e-75
PRK09116405 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) sy 2e-71
PLN02787540 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] sy 4e-64
PRK07103410 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carri 1e-63
PRK08722414 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) sy 8e-61
cd00828407 cd00828, elong_cond_enzymes, "elongating" condensing en 2e-58
PRK07910418 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) sy 5e-54
PRK06501425 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) sy 1e-52
PRK09185392 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) sy 4e-52
PRK05952381 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) sy 2e-44
cd00832399 cd00832, CLF, Chain-length factor (CLF) is a factor req 1e-27
COG0304412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthas 1e-119
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating condens 6e-60
PRK14691342 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) sy 8e-52
cd00833421 cd00833, PKS, polyketide synthases (PKSs) polymerize si 7e-43
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family of en 3e-32
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and relat 2e-31
smart00825424 smart00825, PKS_KS, Beta-ketoacyl synthase 4e-31
KOG1202 2376 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synth 8e-24
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-ter 2e-37
pfam02801117 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-t 5e-24
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturate 2e-16
PRK06519398 PRK06519, PRK06519, 3-oxoacyl-(acyl carrier protein) sy 1e-05
cd00751386 cd00751, thiolase, Thiolase are ubiquitous enzymes that 0.001
PRK08963428 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed 7e-04
TIGR02446430 TIGR02446, FadI, fatty oxidation complex, beta subunit 0.003
>gnl|CDD|181184 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|29421 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|180925 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|163158 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>gnl|CDD|36608 KOG1394, KOG1394, KOG1394, 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180532 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|185415 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>gnl|CDD|181424 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|178430 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>gnl|CDD|181657 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|178384 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>gnl|CDD|181539 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|29415 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|181166 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|180594 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|181683 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|180324 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|29419 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|30652 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|73238 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|173154 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>gnl|CDD|29420 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>gnl|CDD|73194 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|33130 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|129058 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143886 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|145778 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>gnl|CDD|163029 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|180600 PRK06519, PRK06519, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|29411 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 406 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 100.0
PTZ00050477 3-oxoacyl-acyl carrier protein synthase; Provisional 100.0
PRK08439405 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK08768411 consensus 100.0
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
TIGR03150407 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2. FabB 100.0
PRK07103415 polyketide beta-ketoacyl:acyl carrier protein synthase; 100.0
KOG1394440 consensus 100.0
cd00832399 CLF Chain-length factor (CLF) is a factor required for 100.0
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid m 100.0
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synth 100.0
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of beta-ke 100.0
cd00828407 elong_cond_enzymes "elongating" condensing enzymes are 100.0
cd00833421 PKS polyketide synthases (PKSs) polymerize simple fatty 100.0
PRK05952379 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK09185395 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 100.0
COG3321 1061 Polyketide synthase modules and related proteins [Secon 100.0
PRK06519397 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 100.0
KOG1202 2376 consensus 100.0
PRK06147346 3-oxoacyl-(acyl carrier protein) synthase; Validated 100.0
PRK08234400 consensus 99.81
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.75
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.72
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.7
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.69
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 99.68
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.66
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.65
PRK06840337 hypothetical protein; Validated 99.59
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 99.56
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.53
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.52
cd00827324 init_cond_enzymes "initiating" condensing enzymes are a 99.49
PRK04262346 hypothetical protein; Provisional 99.46
PRK09116336 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing enzyme 100.0
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 100.0
PRK08256391 lipid-transfer protein; Provisional 99.86
cd00751386 thiolase Thiolase are ubiquitous enzymes that catalyze 99.85
PRK06363387 consensus 99.84
PRK06365415 acetyl-CoA acetyltransferase; Provisional 99.83
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.83
PRK05790393 acetyl-CoA acetyltransferase; Provisional 99.82
PRK07491392 consensus 99.82
PRK07124402 consensus 99.81
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.81
PRK06065393 acetyl-CoA acetyltransferase; Provisional 99.81
PRK07800393 consensus 99.81
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.81
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.81
PRK06364389 consensus 99.81
PRK09051394 beta-ketothiolase; Provisional 99.8
PRK08371388 consensus 99.8
PRK07025393 consensus 99.79
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.79
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.79
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.79
PRK06845392 consensus 99.79
PRK08041391 consensus 99.78
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.78
PRK09268428 acetyl-CoA acetyltransferase; Provisional 99.77
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.77
PRK05656392 acetyl-CoA acetyltransferase; Provisional 99.77
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.77
PRK08170426 acetyl-CoA acetyltransferase; Provisional 99.77
PRK06025417 acetyl-CoA acetyltransferase; Provisional 99.77
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.77
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.77
PRK07851405 acetyl-CoA acetyltransferase; Provisional 99.77
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.76
PRK06689391 consensus 99.76
PRK06059399 lipid-transfer protein; Provisional 99.75
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.75
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.74
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.74
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.73
PRK06289408 acetyl-CoA acetyltransferase; Provisional 99.71
PRK06157400 acetyl-CoA acetyltransferase; Validated 99.71
PRK07661384 acetyl-CoA acetyltransferase; Provisional 99.71
PRK08963436 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.71
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.7
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.7
PRK06158384 thiolase; Provisional 99.7
PRK08313391 acetyl-CoA acetyltransferase; Provisional 99.69
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.63
pfam00109243 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 100.0
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 97.64
pfam08392290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 97.42
pfam02801117 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal doma 99.97
PRK07937352 lipid-transfer protein; Provisional 99.79
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 99.77
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 99.74
TIGR01930447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 99.69
PRK06066375 acetyl-CoA acetyltransferase; Provisional 99.48
KOG1390396 consensus 99.42
PRK07855386 lipid-transfer protein; Provisional 99.34
KOG1391396 consensus 98.96
KOG1406408 consensus 98.87
KOG1389435 consensus 98.75
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 99.69
TIGR00747329 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; Int 99.5
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 99.33
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid met 98.92
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.65
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] 99.23
KOG1392465 consensus 98.36
pfam00108264 Thiolase_N Thiolase, N-terminal domain. Thiolase is rep 98.66
pfam01154171 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthas 96.66
TIGR02845331 spore_V_AD stage V sporulation protein AD; InterPro: IP 97.96
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 97.47
PRK08257502 acetyl-CoA acetyltransferase; Validated 97.15
pfam07451329 SpoVAD Stage V sporulation protein AD (SpoVAD). This fa 97.08
PRK12404334 stage V sporulation protein AD; Provisional 97.08
PRK08304336 stage V sporulation protein AD; Validated 97.04
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase; InterPro: IPR012793 97.89
TIGR02445385 fadA acetyl-CoA C-acyltransferase FadA; InterPro: IPR01 97.32
pfam0854580 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synt 97.71
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 97.71
pfam0854190 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] sy 92.26
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08768 consensus Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>KOG1394 consensus Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06363 consensus Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK07124 consensus Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07800 consensus Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06364 consensus Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK08371 consensus Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>pfam00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>pfam08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>pfam02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390 consensus Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>KOG1391 consensus Back     alignment and domain information
>KOG1406 consensus Back     alignment and domain information
>KOG1389 consensus Back     alignment and domain information